Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q59H18

- TNI3K_HUMAN

UniProt

Q59H18 - TNI3K_HUMAN

Protein

Serine/threonine-protein kinase TNNI3K

Gene

TNNI3K

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 113 (01 Oct 2014)
      Sequence version 3 (13 Jul 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in cardiac physiology.1 Publication

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.1 Publication

    Cofactori

    Magnesium.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei490 – 4901ATP
    Active sitei588 – 5881Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi469 – 4779ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW
    3. protein binding Source: IntAct
    4. protein C-terminus binding Source: UniProtKB
    5. protein kinase activity Source: UniProtKB
    6. protein serine/threonine kinase activity Source: UniProtKB-KW
    7. troponin I binding Source: UniProtKB

    GO - Biological processi

    1. protein phosphorylation Source: UniProtKB

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Serine/threonine-protein kinase TNNI3K (EC:2.7.11.1)
    Alternative name(s):
    Cardiac ankyrin repeat kinase
    Cardiac troponin I-interacting kinase
    TNNI3-interacting kinase
    Gene namesi
    Name:TNNI3KImported
    Synonyms:CARK
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:19661. TNNI3K.

    Subcellular locationi

    Nucleus 1 Publication. Cytoplasm 1 Publication
    Note: Expressed at lower levels in the cytoplasm.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi490 – 4901K → R: Loss of autophosphorylation activity. 1 Publication

    Organism-specific databases

    PharmGKBiPA134976654.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 835835Serine/threonine-protein kinase TNNI3KPRO_0000086757Add
    BLAST

    Post-translational modificationi

    Autophosphorylated.1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ59H18.
    PRIDEiQ59H18.

    PTM databases

    PhosphoSiteiQ59H18.

    Expressioni

    Tissue specificityi

    Highly expressed in both adult and fetal heart.1 Publication

    Gene expression databases

    BgeeiQ59H18.
    CleanExiHS_TNNI3K.
    GenevestigatoriQ59H18.

    Interactioni

    Subunit structurei

    Interacts with TNNI3, ACTC, ACTA1, MYBPC3, AIP, BABP3 and HADHB.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    TNNI3P194292EBI-704142,EBI-704146

    Protein-protein interaction databases

    BioGridi119276. 8 interactions.
    IntActiQ59H18. 7 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ59H18.
    SMRiQ59H18. Positions 41-720.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati66 – 9631ANK 1Add
    BLAST
    Repeati100 – 12930ANK 2Add
    BLAST
    Repeati133 – 16230ANK 3Add
    BLAST
    Repeati166 – 19530ANK 4Add
    BLAST
    Repeati199 – 22830ANK 5Add
    BLAST
    Repeati234 – 26330ANK 6Add
    BLAST
    Repeati269 – 29830ANK 7Add
    BLAST
    Repeati304 – 33532ANK 8Add
    BLAST
    Repeati339 – 36830ANK 9Add
    BLAST
    Repeati381 – 41030ANK 10Add
    BLAST
    Domaini463 – 723261Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili21 – 5131Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi733 – 74614Poly-SerAdd
    BLAST

    Sequence similaritiesi

    Contains 10 ANK repeats.PROSITE-ProRule annotation
    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Keywords - Domaini

    ANK repeat, Coiled coil, Repeat

    Phylogenomic databases

    HOGENOMiHOG000234421.
    HOVERGENiHBG079513.
    InParanoidiQ59H18.
    KOiK17535.
    OMAiQPHVVNI.
    OrthoDBiEOG7XDBF3.
    PhylomeDBiQ59H18.

    Family and domain databases

    Gene3Di1.25.40.20. 3 hits.
    InterProiIPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    [Graphical view]
    PfamiPF12796. Ank_2. 3 hits.
    PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view]
    PRINTSiPR01415. ANKYRIN.
    SMARTiSM00248. ANK. 10 hits.
    [Graphical view]
    SUPFAMiSSF48403. SSF48403. 1 hit.
    SSF56112. SSF56112. 1 hit.
    PROSITEiPS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 6 hits.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 21 Publication (identifier: Q59H18-2) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGNYKSRPTQ TCTDEWKKKV SESYVITIER LEDDLQIKEK ELTELRNIFG    50
    SDEAFSKVNL NYRTENGLSL LHLCCICGGK KSHIRTLMLK GLRPSRLTRN 100
    GFTALHLAVY KDNAELITSL LHSGADIQQV GYGGLTALHI ATIAGHLEAA 150
    DVLLQHGANV NIQDAVFFTP LHIAAYYGHE QVTRLLLKFG ADVNVSGEVG 200
    DRPLHLASAK GFLNIAKLLM EEGSKADVNA QDNEDHVPLH FCSRFGHHDI 250
    VKYLLQSDLE VQPHVVNIYG DTPLHLACYN GKFEVAKEII QISGTESLTK 300
    ENIFSETAFH SACTYGKSID LVKFLLDQNV ININHQGRDG HTGLHSACYH 350
    GHIRLVQFLL DNGADMNLVA CDPSRSSGEK DEQTCLMWAY EKGHDAIVTL 400
    LKHYKRPQDE LPCNEYSQPG GDGSYVSVPS PLGKIKSMTK EKADILLLRA 450
    GLPSHFHLQL SEIEFHEIIG SGSFGKVYKG RCRNKIVAIK RYRANTYCSK 500
    SDVDMFCREV SILCQLNHPC VIQFVGACLN DPSQFAIVTQ YISGGSLFSL 550
    LHEQKRILDL QSKLIIAVDV AKGMEYLHNL TQPIIHRDLN SHNILLYEDG 600
    HAVVADFGES RFLQSLDEDN MTKQPGNLRW MAPEVFTQCT RYTIKADVFS 650
    YALCLWEILT GEIPFAHLKP AAAAADMAYH HIRPPIGYSI PKPISSLLIR 700
    GWNACPEGRP EFSEVVMKLE ECLCNIELMS PASSNSSGSL SPSSSSDCLV 750
    NRGGPGRSHV AALRSRFELE YALNARSYAA LSQSAGQYSS QGLSLEEMKR 800
    SLQYTPIDKY GYVSDPMSSM HFHSCRNSSS FEDSS 835
    Length:835
    Mass (Da):92,851
    Last modified:July 13, 2010 - v3
    Checksum:i3B21484B434F46E8
    GO
    Isoform 1Curated (identifier: Q59H18-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS

    Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein.

    Show »
    Length:936
    Mass (Da):104,179
    Checksum:i081220549646863F
    GO
    Isoform 3Curated (identifier: Q59H18-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS
         591-596: SHNILL → RYFFPK
         597-835: Missing.

    Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein.

    Show »
    Length:697
    Mass (Da):77,957
    Checksum:i7567E27D45485C9C
    GO
    Isoform 4Curated (identifier: Q59H18-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS
         708-742: GRPEFSEVVMKLEECLCNIELMSPASSNSSGSLSP → AKSRPSHYPVSSVYTETLKKKNEDRFGMWIEYLRR
         743-835: Missing.

    Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein.

    Show »
    Length:843
    Mass (Da):94,517
    Checksum:i3001399FAEAD7B24
    GO

    Sequence cautioni

    The sequence BAD92178.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence CAE45949.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti127 – 1271I → V in AAH32865. (PubMed:15489334)Curated
    Sequence conflicti250 – 2501I → M in CAE45949. (PubMed:17974005)Curated
    Sequence conflicti367 – 3671N → S in CAE45949. (PubMed:17974005)Curated
    Sequence conflicti629 – 6291R → L in AAH32865. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti151 – 1511D → H.1 Publication
    Corresponds to variant rs34874695 [ dbSNP | Ensembl ].
    VAR_041223
    Natural varianti263 – 2631P → L.1 Publication
    Corresponds to variant rs34521608 [ dbSNP | Ensembl ].
    VAR_041224
    Natural varianti309 – 3091F → L.1 Publication
    VAR_041225
    Natural varianti430 – 4301S → L in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication
    VAR_041226
    Natural varianti510 – 5101V → L.1 Publication
    Corresponds to variant rs34335537 [ dbSNP | Ensembl ].
    VAR_041227
    Natural varianti629 – 6291R → G in a colorectal cancer sample; somatic mutation. 1 Publication
    VAR_035639
    Natural varianti637 – 6371T → M.1 Publication
    Corresponds to variant rs2274260 [ dbSNP | Ensembl ].
    VAR_041228
    Natural varianti686 – 6861I → T.1 Publication
    Corresponds to variant rs3737564 [ dbSNP | Ensembl ].
    VAR_041229
    Natural varianti785 – 7851A → G.1 Publication
    Corresponds to variant rs45578635 [ dbSNP | Ensembl ].
    VAR_038821
    Natural varianti798 – 7981M → I in a head & Neck squamous cell carcinoma sample; somatic mutation. 1 Publication
    VAR_041230
    Natural varianti833 – 8331D → Y.1 Publication
    Corresponds to variant rs45614933 [ dbSNP | Ensembl ].
    VAR_038822

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1313MGNYK…TQTCT → MAAARDPPEVSLREATQRKL RRFSELRGKLVARGEFWDIV AITAADEKQELAYNQQLSEK LKRKELPLGVQYHVFVDPAG AKIGNGGSTLCALQCLEKLY GDKWNSFTILLIHS in isoform 1, isoform 3 and isoform 4. 3 PublicationsVSP_039403Add
    BLAST
    Alternative sequencei591 – 5966SHNILL → RYFFPK in isoform 3. 1 PublicationVSP_051882
    Alternative sequencei597 – 835239Missing in isoform 3. 1 PublicationVSP_051883Add
    BLAST
    Alternative sequencei708 – 74235GRPEF…GSLSP → AKSRPSHYPVSSVYTETLKK KNEDRFGMWIEYLRR in isoform 4. 1 PublicationVSP_051884Add
    BLAST
    Alternative sequencei743 – 83593Missing in isoform 4. 1 PublicationVSP_051885Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF116826 mRNA. Translation: AAD29632.1.
    AY303691 mRNA. Translation: AAP72030.1.
    AB208941 Transcribed RNA. Translation: BAD92178.1. Different initiation.
    BX640903 mRNA. Translation: CAE45949.1. Different initiation.
    DQ822519 Genomic DNA. Translation: ABG46944.1.
    BX470253
    , AC093158, AC098692, AC105271, AC119672 Genomic DNA. Translation: CAI16293.1.
    CH471059 Genomic DNA. Translation: EAX06415.1.
    BC032865 mRNA. Translation: AAH32865.1.
    BC113539 mRNA. Translation: AAI13540.1.
    BC117262 mRNA. Translation: AAI17263.1.
    CCDSiCCDS664.1. [Q59H18-2]
    RefSeqiNP_001186256.2. NM_001199327.1.
    NP_057062.1. NM_015978.2. [Q59H18-2]
    UniGeneiHs.480085.

    Genome annotation databases

    EnsembliENST00000326637; ENSP00000322251; ENSG00000116783. [Q59H18-2]
    GeneIDi100526835.
    51086.
    KEGGihsa:100526835.
    hsa:51086.
    UCSCiuc001dgc.2. human. [Q59H18-3]
    uc001dgd.3. human. [Q59H18-4]
    uc001dge.2. human. [Q59H18-1]
    uc001dgf.2. human. [Q59H18-2]

    Polymorphism databases

    DMDMi300669705.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    SeattleSNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF116826 mRNA. Translation: AAD29632.1 .
    AY303691 mRNA. Translation: AAP72030.1 .
    AB208941 Transcribed RNA. Translation: BAD92178.1 . Different initiation.
    BX640903 mRNA. Translation: CAE45949.1 . Different initiation.
    DQ822519 Genomic DNA. Translation: ABG46944.1 .
    BX470253
    , AC093158 , AC098692 , AC105271 , AC119672 Genomic DNA. Translation: CAI16293.1 .
    CH471059 Genomic DNA. Translation: EAX06415.1 .
    BC032865 mRNA. Translation: AAH32865.1 .
    BC113539 mRNA. Translation: AAI13540.1 .
    BC117262 mRNA. Translation: AAI17263.1 .
    CCDSi CCDS664.1. [Q59H18-2 ]
    RefSeqi NP_001186256.2. NM_001199327.1.
    NP_057062.1. NM_015978.2. [Q59H18-2 ]
    UniGenei Hs.480085.

    3D structure databases

    ProteinModelPortali Q59H18.
    SMRi Q59H18. Positions 41-720.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119276. 8 interactions.
    IntActi Q59H18. 7 interactions.

    Chemistry

    BindingDBi Q59H18.
    ChEMBLi CHEMBL5260.
    GuidetoPHARMACOLOGYi 2247.

    PTM databases

    PhosphoSitei Q59H18.

    Polymorphism databases

    DMDMi 300669705.

    Proteomic databases

    MaxQBi Q59H18.
    PRIDEi Q59H18.

    Protocols and materials databases

    DNASUi 51086.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000326637 ; ENSP00000322251 ; ENSG00000116783 . [Q59H18-2 ]
    GeneIDi 100526835.
    51086.
    KEGGi hsa:100526835.
    hsa:51086.
    UCSCi uc001dgc.2. human. [Q59H18-3 ]
    uc001dgd.3. human. [Q59H18-4 ]
    uc001dge.2. human. [Q59H18-1 ]
    uc001dgf.2. human. [Q59H18-2 ]

    Organism-specific databases

    CTDi 100526835.
    51086.
    GeneCardsi GC01P074669.
    HGNCi HGNC:19661. TNNI3K.
    MIMi 613932. gene.
    neXtProti NX_Q59H18.
    PharmGKBi PA134976654.
    GenAtlasi Search...

    Phylogenomic databases

    HOGENOMi HOG000234421.
    HOVERGENi HBG079513.
    InParanoidi Q59H18.
    KOi K17535.
    OMAi QPHVVNI.
    OrthoDBi EOG7XDBF3.
    PhylomeDBi Q59H18.

    Miscellaneous databases

    NextBioi 53751.
    PROi Q59H18.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q59H18.
    CleanExi HS_TNNI3K.
    Genevestigatori Q59H18.

    Family and domain databases

    Gene3Di 1.25.40.20. 3 hits.
    InterProi IPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
    [Graphical view ]
    Pfami PF12796. Ank_2. 3 hits.
    PF07714. Pkinase_Tyr. 1 hit.
    [Graphical view ]
    PRINTSi PR01415. ANKYRIN.
    SMARTi SM00248. ANK. 10 hits.
    [Graphical view ]
    SUPFAMi SSF48403. SSF48403. 1 hit.
    SSF56112. SSF56112. 1 hit.
    PROSITEi PS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 6 hits.
    PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of a novel cardiac-specific kinase that interacts specifically with cardiac troponin I."
      Zhao Y., Meng X.-M., Wei Y.-J., Zhao X.-W., Liu D.-Q., Cao H.-Q., Liew C.-C., Ding J.-F.
      J. Mol. Med. 81:297-304(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, AUTOPHOSPHORYLATION, INTERACTION WITH TNNI3; ACTC; ACTA1; MYBPC3; AIP; BABP3 AND HADHB, MUTAGENESIS OF LYS-490.
      Tissue: HeartImported.
    2. "Cardiac ankyrin repeat kinase (CARK)."
      Jeyaseelan R.
      Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    3. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: BrainImported.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Fetal kidney.
    5. SeattleSNPs variation discovery resource
      Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLY-785 AND TYR-833.
    6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
      Tissue: BrainImported.
    9. Cited for: VARIANT [LARGE SCALE ANALYSIS] GLY-629.
    10. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-151; LEU-263; LEU-309; LEU-430; LEU-510; MET-637; THR-686 AND ILE-798.

    Entry informationi

    Entry nameiTNI3K_HUMAN
    AccessioniPrimary (citable) accession number: Q59H18
    Secondary accession number(s): Q17RN0
    , Q49AR1, Q6MZS9, Q9Y2V6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 22, 2005
    Last sequence update: July 13, 2010
    Last modified: October 1, 2014
    This is version 113 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3