Q59H18 (TNI3K_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein kinase TNNI3K EC=2.7.11.1 Alternative name(s): Cardiac ankyrin repeat kinase Cardiac troponin I-interacting kinase TNNI3-interacting kinase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 835 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in cardiac physiology. Ref.1 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. Ref.1 |
| Cofactor | Magnesium. Ref.1 |
| Subunit structure | Interacts with TNNI3, ACTC, ACTA1, MYBPC3, AIP, BABP3 and HADHB. Ref.1 |
| Subcellular location | Nucleus. Cytoplasm. Note: Expressed at lower levels in the cytoplasm. Ref.1 |
| Tissue specificity | Highly expressed in both adult and fetal heart. Ref.1 |
| Post-translational modification | Autophosphorylated. Ref.1 |
| Sequence similarities | Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily. Contains 10 ANK repeats. Contains 1 protein kinase domain. |
| Sequence caution | The sequence BAD92178.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAE45949.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | ANK repeat Coiled coil Repeat |
| Ligand | ATP-binding Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from direct assay Ref.1PubMed 18205602. Source: UniProtKB nucleusInferred from direct assay Ref.1. Source: UniProtKB |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW protein kinase activityInferred from direct assay Ref.1. Source: UniProtKB protein serine/threonine kinase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| TNNI3 | P19429 | 2 | EBI-704142,EBI-704146 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 Ref.1 (identifier: Q59H18-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q59H18-1) The sequence of this isoform differs from the canonical sequence as follows: 1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS | ||||||
| Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein. | ||||||
| Isoform 3 (identifier: Q59H18-3) The sequence of this isoform differs from the canonical sequence as follows: 1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS 591-596: SHNILL → RYFFPK 597-835: Missing. | ||||||
| Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein. | ||||||
| Isoform 4 (identifier: Q59H18-4) The sequence of this isoform differs from the canonical sequence as follows: 1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS 708-742: GRPEFSEVVMKLEECLCNIELMSPASSNSSGSLSP → AKSRPSHYPVSSVYTETLKKKNEDRFGMWIEYLRR 743-835: Missing. | ||||||
| Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 835 | 835 | Serine/threonine-protein kinase TNNI3K | PRO_0000086757 | |||||
Regions | |||||||||
| Repeat | 66 – 96 | 31 | ANK 1 | ||||||
| Repeat | 100 – 129 | 30 | ANK 2 | ||||||
| Repeat | 133 – 162 | 30 | ANK 3 | ||||||
| Repeat | 166 – 195 | 30 | ANK 4 | ||||||
| Repeat | 199 – 228 | 30 | ANK 5 | ||||||
| Repeat | 234 – 263 | 30 | ANK 6 | ||||||
| Repeat | 269 – 298 | 30 | ANK 7 | ||||||
| Repeat | 304 – 335 | 32 | ANK 8 | ||||||
| Repeat | 339 – 368 | 30 | ANK 9 | ||||||
| Repeat | 381 – 410 | 30 | ANK 10 | ||||||
| Domain | 463 – 723 | 261 | Protein kinase | ||||||
| Nucleotide binding | 469 – 477 | 9 | ATP By similarity | ||||||
| Coiled coil | 21 – 51 | 31 | Potential | ||||||
| Compositional bias | 733 – 746 | 14 | Poly-Ser | ||||||
Sites | |||||||||
| Active site | 588 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 490 | 1 | ATP | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 13 | 13 | MGNYK…TQTCT → MAAARDPPEVSLREATQRKL RRFSELRGKLVARGEFWDIV AITAADEKQELAYNQQLSEK LKRKELPLGVQYHVFVDPAG AKIGNGGSTLCALQCLEKLY GDKWNSFTILLIHS in isoform 1, isoform 3 and isoform 4. | VSP_039403 | |||||
| Alternative sequence | 591 – 596 | 6 | SHNILL → RYFFPK in isoform 3. | VSP_051882 | |||||
| Alternative sequence | 597 – 835 | 239 | Missing in isoform 3. | VSP_051883 | |||||
| Alternative sequence | 708 – 742 | 35 | GRPEF…GSLSP → AKSRPSHYPVSSVYTETLKK KNEDRFGMWIEYLRR in isoform 4. | VSP_051884 | |||||
| Alternative sequence | 743 – 835 | 93 | Missing in isoform 4. | VSP_051885 | |||||
| Natural variant | 151 | 1 | D → H. Ref.10 Corresponds to variant rs34874695 [ dbSNP | Ensembl ]. | VAR_041223 | |||||
| Natural variant | 263 | 1 | P → L. Ref.10 Corresponds to variant rs34521608 [ dbSNP | Ensembl ]. | VAR_041224 | |||||
| Natural variant | 309 | 1 | F → L. Ref.10 | VAR_041225 | |||||
| Natural variant | 430 | 1 | S → L in a colorectal adenocarcinoma sample; somatic mutation. Ref.10 | VAR_041226 | |||||
| Natural variant | 510 | 1 | V → L. Ref.10 Corresponds to variant rs34335537 [ dbSNP | Ensembl ]. | VAR_041227 | |||||
| Natural variant | 629 | 1 | R → G in a colorectal cancer sample; somatic mutation. Ref.9 | VAR_035639 | |||||
| Natural variant | 637 | 1 | T → M. Ref.10 Corresponds to variant rs2274260 [ dbSNP | Ensembl ]. | VAR_041228 | |||||
| Natural variant | 686 | 1 | I → T. Ref.10 Corresponds to variant rs3737564 [ dbSNP | Ensembl ]. | VAR_041229 | |||||
| Natural variant | 785 | 1 | A → G. Ref.5 Corresponds to variant rs45578635 [ dbSNP | Ensembl ]. | VAR_038821 | |||||
| Natural variant | 798 | 1 | M → I in a head & Neck squamous cell carcinoma sample; somatic mutation. Ref.10 | VAR_041230 | |||||
| Natural variant | 833 | 1 | D → Y. Ref.5 Corresponds to variant rs45614933 [ dbSNP | Ensembl ]. | VAR_038822 | |||||
Experimental info | |||||||||
| Mutagenesis | 490 | 1 | K → R: Loss of autophosphorylation activity. Ref.1 | ||||||
| Sequence conflict | 127 | 1 | I → V in AAH32865. Ref.8 | ||||||
| Sequence conflict | 250 | 1 | I → M in CAE45949. Ref.4 | ||||||
| Sequence conflict | 367 | 1 | N → S in CAE45949. Ref.4 | ||||||
| Sequence conflict | 629 | 1 | R → L in AAH32865. Ref.8 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a novel cardiac-specific kinase that interacts specifically with cardiac troponin I." Zhao Y., Meng X.-M., Wei Y.-J., Zhao X.-W., Liu D.-Q., Cao H.-Q., Liew C.-C., Ding J.-F. J. Mol. Med. 81:297-304(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, AUTOPHOSPHORYLATION, INTERACTION WITH TNNI3; ACTC; ACTA1; MYBPC3; AIP; BABP3 AND HADHB, MUTAGENESIS OF LYS-490. Tissue: Heart. |
| [2] | "Cardiac ankyrin repeat kinase (CARK)." Jeyaseelan R. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Fetal kidney. |
| [5] | SeattleSNPs variation discovery resource Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLY-785 AND TYR-833. |
| [6] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Tissue: Brain. |
| [9] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] GLY-629. |
| [10] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-151; LEU-263; LEU-309; LEU-430; LEU-510; MET-637; THR-686 AND ILE-798. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF116826 mRNA. Translation: AAD29632.1. AY303691 mRNA. Translation: AAP72030.1. AB208941 Transcribed RNA. Translation: BAD92178.1. Different initiation. BX640903 mRNA. Translation: CAE45949.1. Different initiation. DQ822519 Genomic DNA. Translation: ABG46944.1. BX470253 AC119672 Genomic DNA. Translation: CAI16293.1.CH471059 Genomic DNA. Translation: EAX06415.1. BC032865 mRNA. Translation: AAH32865.1. BC113539 mRNA. Translation: AAI13540.1. BC117262 mRNA. Translation: AAI17263.1. |
| IPI | IPI00006465. IPI00644212. IPI00645178. IPI00655547. |
| RefSeq | NP_001106279.1. NM_001112808.2. NP_001186256.1. NM_001199327.1. NP_057062.1. NM_015978.2. |
| UniGene | Hs.480085. |
3D structure databases | |
| ProteinModelPortal | Q59H18. |
| SMR | Q59H18. Positions 38-721. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q59H18. 7 interactions. |
PTM databases | |
| PhosphoSite | Q59H18. |
Polymorphism databases | |
| DMDM | 300669705. |
Proteomic databases | |
| PRIDE | Q59H18. |
Protocols and materials databases | |
| DNASU | 51086. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000326637; ENSP00000322251; ENSG00000116783. ENST00000370891; ENSP00000359928; ENSG00000116783. |
| GeneID | 100526835. 51086. |
| KEGG | hsa:100526835. hsa:51086. |
| UCSC | uc001dgc.2. human. uc001dgd.3. human. uc001dge.2. human. uc001dgf.2. human. |
Organism-specific databases | |
| CTD | 100526835. 51086. |
| GeneCards | GC01P074669. GC01P074671. |
| HGNC | HGNC:19661. TNNI3K. |
| MIM | 613932. gene. |
| neXtProt | NX_Q59H18. |
| PharmGKB | PA134976654. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | HOG000234421. |
| HOVERGEN | HBG079513. |
| InParanoid | Q59H18. |
| OMA | HVVNIYG. |
| PhylomeDB | Q59H18. |
Gene expression databases | |
| ArrayExpress | Q59H18. |
| Bgee | Q59H18. |
| CleanEx | HS_TNNI3K. |
| Genevestigator | Q59H18. |
| GermOnline | ENSG00000116783. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.25.40.20. 3 hits. |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR001245. Ser-Thr/Tyr_kinase_cat_dom. [Graphical view] |
| Pfam | PF00023. Ank. 1 hit. PF12796. Ank_2. 2 hits. PF07714. Pkinase_Tyr. 1 hit. [Graphical view] |
| PRINTS | PR01415. ANKYRIN. |
| SMART | SM00248. ANK. 10 hits. [Graphical view] |
| SUPFAM | SSF48403. ANK. 1 hit. SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 6 hits. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q59H18. |
| ChEMBL | CHEMBL5260. |
| NextBio | 53751. |
| SOURCE | Search... |
Entry information
| Entry name | TNI3K_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q59H18 Secondary accession number(s): Q17RN0 Q9Y2V6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
