Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q59H18

- TNI3K_HUMAN

UniProt

Q59H18 - TNI3K_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Serine/threonine-protein kinase TNNI3K

Gene

TNNI3K

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play a role in cardiac physiology.1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.1 Publication

Cofactori

Mg2+1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei490 – 4901ATP
Active sitei588 – 5881Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi469 – 4779ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW
  3. protein C-terminus binding Source: UniProtKB
  4. protein kinase activity Source: UniProtKB
  5. protein serine/threonine kinase activity Source: UniProtKB-KW
  6. troponin I binding Source: UniProtKB

GO - Biological processi

  1. protein phosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase TNNI3K (EC:2.7.11.1)
Alternative name(s):
Cardiac ankyrin repeat kinase
Cardiac troponin I-interacting kinase
TNNI3-interacting kinase
Gene namesi
Name:TNNI3KImported
Synonyms:CARK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:19661. TNNI3K.

Subcellular locationi

Nucleus 1 Publication. Cytoplasm 1 Publication
Note: Expressed at lower levels in the cytoplasm.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi490 – 4901K → R: Loss of autophosphorylation activity. 1 Publication

Organism-specific databases

PharmGKBiPA134976654.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 835835Serine/threonine-protein kinase TNNI3KPRO_0000086757Add
BLAST

Post-translational modificationi

Autophosphorylated.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ59H18.
PRIDEiQ59H18.

PTM databases

PhosphoSiteiQ59H18.

Expressioni

Tissue specificityi

Highly expressed in both adult and fetal heart.1 Publication

Gene expression databases

BgeeiQ59H18.
CleanExiHS_TNNI3K.
ExpressionAtlasiQ59H18. baseline.
GenevestigatoriQ59H18.

Interactioni

Subunit structurei

Interacts with TNNI3, ACTC, ACTA1, MYBPC3, AIP, BABP3 and HADHB.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
TNNI3P194292EBI-704142,EBI-704146

Protein-protein interaction databases

BioGridi119276. 8 interactions.
IntActiQ59H18. 7 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ59H18.
SMRiQ59H18. Positions 38-720.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati66 – 9631ANK 1Add
BLAST
Repeati100 – 12930ANK 2Add
BLAST
Repeati133 – 16230ANK 3Add
BLAST
Repeati166 – 19530ANK 4Add
BLAST
Repeati199 – 22830ANK 5Add
BLAST
Repeati234 – 26330ANK 6Add
BLAST
Repeati269 – 29830ANK 7Add
BLAST
Repeati304 – 33532ANK 8Add
BLAST
Repeati339 – 36830ANK 9Add
BLAST
Repeati381 – 41030ANK 10Add
BLAST
Domaini463 – 723261Protein kinasePROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili21 – 5131Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi733 – 74614Poly-SerAdd
BLAST

Sequence similaritiesi

Contains 10 ANK repeats.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

GeneTreeiENSGT00770000120618.
HOGENOMiHOG000234421.
HOVERGENiHBG079513.
InParanoidiQ59H18.
KOiK17535.
OMAiQPHVVNI.
OrthoDBiEOG7XDBF3.
PhylomeDBiQ59H18.

Family and domain databases

Gene3Di1.25.40.20. 3 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
[Graphical view]
PfamiPF12796. Ank_2. 3 hits.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 10 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 6 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 21 Publication (identifier: Q59H18-2) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNYKSRPTQ TCTDEWKKKV SESYVITIER LEDDLQIKEK ELTELRNIFG
60 70 80 90 100
SDEAFSKVNL NYRTENGLSL LHLCCICGGK KSHIRTLMLK GLRPSRLTRN
110 120 130 140 150
GFTALHLAVY KDNAELITSL LHSGADIQQV GYGGLTALHI ATIAGHLEAA
160 170 180 190 200
DVLLQHGANV NIQDAVFFTP LHIAAYYGHE QVTRLLLKFG ADVNVSGEVG
210 220 230 240 250
DRPLHLASAK GFLNIAKLLM EEGSKADVNA QDNEDHVPLH FCSRFGHHDI
260 270 280 290 300
VKYLLQSDLE VQPHVVNIYG DTPLHLACYN GKFEVAKEII QISGTESLTK
310 320 330 340 350
ENIFSETAFH SACTYGKSID LVKFLLDQNV ININHQGRDG HTGLHSACYH
360 370 380 390 400
GHIRLVQFLL DNGADMNLVA CDPSRSSGEK DEQTCLMWAY EKGHDAIVTL
410 420 430 440 450
LKHYKRPQDE LPCNEYSQPG GDGSYVSVPS PLGKIKSMTK EKADILLLRA
460 470 480 490 500
GLPSHFHLQL SEIEFHEIIG SGSFGKVYKG RCRNKIVAIK RYRANTYCSK
510 520 530 540 550
SDVDMFCREV SILCQLNHPC VIQFVGACLN DPSQFAIVTQ YISGGSLFSL
560 570 580 590 600
LHEQKRILDL QSKLIIAVDV AKGMEYLHNL TQPIIHRDLN SHNILLYEDG
610 620 630 640 650
HAVVADFGES RFLQSLDEDN MTKQPGNLRW MAPEVFTQCT RYTIKADVFS
660 670 680 690 700
YALCLWEILT GEIPFAHLKP AAAAADMAYH HIRPPIGYSI PKPISSLLIR
710 720 730 740 750
GWNACPEGRP EFSEVVMKLE ECLCNIELMS PASSNSSGSL SPSSSSDCLV
760 770 780 790 800
NRGGPGRSHV AALRSRFELE YALNARSYAA LSQSAGQYSS QGLSLEEMKR
810 820 830
SLQYTPIDKY GYVSDPMSSM HFHSCRNSSS FEDSS
Length:835
Mass (Da):92,851
Last modified:July 13, 2010 - v3
Checksum:i3B21484B434F46E8
GO
Isoform 1Curated (identifier: Q59H18-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS

Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein.

Show »
Length:936
Mass (Da):104,179
Checksum:i081220549646863F
GO
Isoform 3Curated (identifier: Q59H18-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS
     591-596: SHNILL → RYFFPK
     597-835: Missing.

Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein.

Show »
Length:697
Mass (Da):77,957
Checksum:i7567E27D45485C9C
GO
Isoform 4Curated (identifier: Q59H18-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS
     708-742: GRPEFSEVVMKLEECLCNIELMSPASSNSSGSLSP → AKSRPSHYPVSSVYTETLKKKNEDRFGMWIEYLRR
     743-835: Missing.

Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein.

Show »
Length:843
Mass (Da):94,517
Checksum:i3001399FAEAD7B24
GO

Sequence cautioni

The sequence BAD92178.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAE45949.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti127 – 1271I → V in AAH32865. (PubMed:15489334)Curated
Sequence conflicti250 – 2501I → M in CAE45949. (PubMed:17974005)Curated
Sequence conflicti367 – 3671N → S in CAE45949. (PubMed:17974005)Curated
Sequence conflicti629 – 6291R → L in AAH32865. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti151 – 1511D → H.1 Publication
Corresponds to variant rs34874695 [ dbSNP | Ensembl ].
VAR_041223
Natural varianti263 – 2631P → L.1 Publication
Corresponds to variant rs34521608 [ dbSNP | Ensembl ].
VAR_041224
Natural varianti309 – 3091F → L.1 Publication
VAR_041225
Natural varianti430 – 4301S → L in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication
VAR_041226
Natural varianti510 – 5101V → L.1 Publication
Corresponds to variant rs34335537 [ dbSNP | Ensembl ].
VAR_041227
Natural varianti629 – 6291R → G in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_035639
Natural varianti637 – 6371T → M.1 Publication
Corresponds to variant rs2274260 [ dbSNP | Ensembl ].
VAR_041228
Natural varianti686 – 6861I → T.1 Publication
Corresponds to variant rs3737564 [ dbSNP | Ensembl ].
VAR_041229
Natural varianti785 – 7851A → G.1 Publication
Corresponds to variant rs45578635 [ dbSNP | Ensembl ].
VAR_038821
Natural varianti798 – 7981M → I in a head & Neck squamous cell carcinoma sample; somatic mutation. 1 Publication
VAR_041230
Natural varianti833 – 8331D → Y.1 Publication
Corresponds to variant rs45614933 [ dbSNP | Ensembl ].
VAR_038822

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1313MGNYK…TQTCT → MAAARDPPEVSLREATQRKL RRFSELRGKLVARGEFWDIV AITAADEKQELAYNQQLSEK LKRKELPLGVQYHVFVDPAG AKIGNGGSTLCALQCLEKLY GDKWNSFTILLIHS in isoform 1, isoform 3 and isoform 4. 3 PublicationsVSP_039403Add
BLAST
Alternative sequencei591 – 5966SHNILL → RYFFPK in isoform 3. 1 PublicationVSP_051882
Alternative sequencei597 – 835239Missing in isoform 3. 1 PublicationVSP_051883Add
BLAST
Alternative sequencei708 – 74235GRPEF…GSLSP → AKSRPSHYPVSSVYTETLKK KNEDRFGMWIEYLRR in isoform 4. 1 PublicationVSP_051884Add
BLAST
Alternative sequencei743 – 83593Missing in isoform 4. 1 PublicationVSP_051885Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF116826 mRNA. Translation: AAD29632.1.
AY303691 mRNA. Translation: AAP72030.1.
AB208941 Transcribed RNA. Translation: BAD92178.1. Different initiation.
BX640903 mRNA. Translation: CAE45949.1. Different initiation.
DQ822519 Genomic DNA. Translation: ABG46944.1.
BX470253
, AC093158, AC098692, AC105271, AC119672 Genomic DNA. Translation: CAI16293.1.
CH471059 Genomic DNA. Translation: EAX06415.1.
BC032865 mRNA. Translation: AAH32865.1.
BC113539 mRNA. Translation: AAI13540.1.
BC117262 mRNA. Translation: AAI17263.1.
CCDSiCCDS664.1. [Q59H18-2]
RefSeqiNP_001186256.2. NM_001199327.1.
NP_057062.1. NM_015978.2. [Q59H18-2]
UniGeneiHs.480085.

Genome annotation databases

EnsembliENST00000326637; ENSP00000322251; ENSG00000116783. [Q59H18-2]
GeneIDi100526835.
51086.
KEGGihsa:100526835.
hsa:51086.
UCSCiuc001dgc.2. human. [Q59H18-3]
uc001dgd.3. human. [Q59H18-4]
uc001dge.2. human. [Q59H18-1]
uc001dgf.2. human. [Q59H18-2]

Polymorphism databases

DMDMi300669705.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF116826 mRNA. Translation: AAD29632.1 .
AY303691 mRNA. Translation: AAP72030.1 .
AB208941 Transcribed RNA. Translation: BAD92178.1 . Different initiation.
BX640903 mRNA. Translation: CAE45949.1 . Different initiation.
DQ822519 Genomic DNA. Translation: ABG46944.1 .
BX470253
, AC093158 , AC098692 , AC105271 , AC119672 Genomic DNA. Translation: CAI16293.1 .
CH471059 Genomic DNA. Translation: EAX06415.1 .
BC032865 mRNA. Translation: AAH32865.1 .
BC113539 mRNA. Translation: AAI13540.1 .
BC117262 mRNA. Translation: AAI17263.1 .
CCDSi CCDS664.1. [Q59H18-2 ]
RefSeqi NP_001186256.2. NM_001199327.1.
NP_057062.1. NM_015978.2. [Q59H18-2 ]
UniGenei Hs.480085.

3D structure databases

ProteinModelPortali Q59H18.
SMRi Q59H18. Positions 38-720.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119276. 8 interactions.
IntActi Q59H18. 7 interactions.

Chemistry

BindingDBi Q59H18.
ChEMBLi CHEMBL5260.
GuidetoPHARMACOLOGYi 2247.

PTM databases

PhosphoSitei Q59H18.

Polymorphism databases

DMDMi 300669705.

Proteomic databases

MaxQBi Q59H18.
PRIDEi Q59H18.

Protocols and materials databases

DNASUi 51086.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000326637 ; ENSP00000322251 ; ENSG00000116783 . [Q59H18-2 ]
GeneIDi 100526835.
51086.
KEGGi hsa:100526835.
hsa:51086.
UCSCi uc001dgc.2. human. [Q59H18-3 ]
uc001dgd.3. human. [Q59H18-4 ]
uc001dge.2. human. [Q59H18-1 ]
uc001dgf.2. human. [Q59H18-2 ]

Organism-specific databases

CTDi 100526835.
51086.
GeneCardsi GC01P074673.
HGNCi HGNC:19661. TNNI3K.
MIMi 613932. gene.
neXtProti NX_Q59H18.
PharmGKBi PA134976654.
GenAtlasi Search...

Phylogenomic databases

GeneTreei ENSGT00770000120618.
HOGENOMi HOG000234421.
HOVERGENi HBG079513.
InParanoidi Q59H18.
KOi K17535.
OMAi QPHVVNI.
OrthoDBi EOG7XDBF3.
PhylomeDBi Q59H18.

Miscellaneous databases

NextBioi 53751.
PROi Q59H18.
SOURCEi Search...

Gene expression databases

Bgeei Q59H18.
CleanExi HS_TNNI3K.
ExpressionAtlasi Q59H18. baseline.
Genevestigatori Q59H18.

Family and domain databases

Gene3Di 1.25.40.20. 3 hits.
InterProi IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
[Graphical view ]
Pfami PF12796. Ank_2. 3 hits.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view ]
PRINTSi PR01415. ANKYRIN.
SMARTi SM00248. ANK. 10 hits.
[Graphical view ]
SUPFAMi SSF48403. SSF48403. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEi PS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 6 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel cardiac-specific kinase that interacts specifically with cardiac troponin I."
    Zhao Y., Meng X.-M., Wei Y.-J., Zhao X.-W., Liu D.-Q., Cao H.-Q., Liew C.-C., Ding J.-F.
    J. Mol. Med. 81:297-304(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, AUTOPHOSPHORYLATION, INTERACTION WITH TNNI3; ACTC; ACTA1; MYBPC3; AIP; BABP3 AND HADHB, MUTAGENESIS OF LYS-490.
    Tissue: HeartImported.
  2. "Cardiac ankyrin repeat kinase (CARK)."
    Jeyaseelan R.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  3. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: BrainImported.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Fetal kidney.
  5. SeattleSNPs variation discovery resource
    Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLY-785 AND TYR-833.
  6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Tissue: BrainImported.
  9. Cited for: VARIANT [LARGE SCALE ANALYSIS] GLY-629.
  10. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-151; LEU-263; LEU-309; LEU-430; LEU-510; MET-637; THR-686 AND ILE-798.

Entry informationi

Entry nameiTNI3K_HUMAN
AccessioniPrimary (citable) accession number: Q59H18
Secondary accession number(s): Q17RN0
, Q49AR1, Q6MZS9, Q9Y2V6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: July 13, 2010
Last modified: November 26, 2014
This is version 115 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3