SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q59H18

- TNI3K_HUMAN

UniProt

Q59H18 - TNI3K_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Serine/threonine-protein kinase TNNI3K
Gene
TNNI3K, CARK
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May play a role in cardiac physiology.1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.1 Publication

Cofactori

Magnesium.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei490 – 4901ATP
Active sitei588 – 5881Proton acceptor By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi469 – 4779ATP By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW
  3. protein C-terminus binding Source: UniProtKB
  4. protein binding Source: IntAct
  5. protein kinase activity Source: UniProtKB
  6. protein serine/threonine kinase activity Source: UniProtKB-KW
  7. troponin I binding Source: UniProtKB

GO - Biological processi

  1. protein phosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase TNNI3K (EC:2.7.11.1)
Alternative name(s):
Cardiac ankyrin repeat kinase
Cardiac troponin I-interacting kinase
TNNI3-interacting kinase
Gene namesi
Name:TNNI3K
Synonyms:CARK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:19661. TNNI3K.

Subcellular locationi

Nucleus. Cytoplasm
Note: Expressed at lower levels in the cytoplasm.1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi490 – 4901K → R: Loss of autophosphorylation activity. 1 Publication

Organism-specific databases

PharmGKBiPA134976654.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 835835Serine/threonine-protein kinase TNNI3K
PRO_0000086757Add
BLAST

Post-translational modificationi

Autophosphorylated.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ59H18.
PRIDEiQ59H18.

PTM databases

PhosphoSiteiQ59H18.

Expressioni

Tissue specificityi

Highly expressed in both adult and fetal heart.1 Publication

Gene expression databases

BgeeiQ59H18.
CleanExiHS_TNNI3K.
GenevestigatoriQ59H18.

Interactioni

Subunit structurei

Interacts with TNNI3, ACTC, ACTA1, MYBPC3, AIP, BABP3 and HADHB.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
TNNI3P194292EBI-704142,EBI-704146

Protein-protein interaction databases

BioGridi119276. 8 interactions.
IntActiQ59H18. 7 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ59H18.
SMRiQ59H18. Positions 41-720.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati66 – 9631ANK 1
Add
BLAST
Repeati100 – 12930ANK 2
Add
BLAST
Repeati133 – 16230ANK 3
Add
BLAST
Repeati166 – 19530ANK 4
Add
BLAST
Repeati199 – 22830ANK 5
Add
BLAST
Repeati234 – 26330ANK 6
Add
BLAST
Repeati269 – 29830ANK 7
Add
BLAST
Repeati304 – 33532ANK 8
Add
BLAST
Repeati339 – 36830ANK 9
Add
BLAST
Repeati381 – 41030ANK 10
Add
BLAST
Domaini463 – 723261Protein kinase
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili21 – 5131 Reviewed prediction
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi733 – 74614Poly-Ser
Add
BLAST

Sequence similaritiesi

Contains 10 ANK repeats.

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

HOGENOMiHOG000234421.
HOVERGENiHBG079513.
InParanoidiQ59H18.
KOiK17535.
OMAiQPHVVNI.
OrthoDBiEOG7XDBF3.
PhylomeDBiQ59H18.

Family and domain databases

Gene3Di1.25.40.20. 3 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
[Graphical view]
PfamiPF12796. Ank_2. 3 hits.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 10 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 6 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 21 Publication (identifier: Q59H18-2) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGNYKSRPTQ TCTDEWKKKV SESYVITIER LEDDLQIKEK ELTELRNIFG    50
SDEAFSKVNL NYRTENGLSL LHLCCICGGK KSHIRTLMLK GLRPSRLTRN 100
GFTALHLAVY KDNAELITSL LHSGADIQQV GYGGLTALHI ATIAGHLEAA 150
DVLLQHGANV NIQDAVFFTP LHIAAYYGHE QVTRLLLKFG ADVNVSGEVG 200
DRPLHLASAK GFLNIAKLLM EEGSKADVNA QDNEDHVPLH FCSRFGHHDI 250
VKYLLQSDLE VQPHVVNIYG DTPLHLACYN GKFEVAKEII QISGTESLTK 300
ENIFSETAFH SACTYGKSID LVKFLLDQNV ININHQGRDG HTGLHSACYH 350
GHIRLVQFLL DNGADMNLVA CDPSRSSGEK DEQTCLMWAY EKGHDAIVTL 400
LKHYKRPQDE LPCNEYSQPG GDGSYVSVPS PLGKIKSMTK EKADILLLRA 450
GLPSHFHLQL SEIEFHEIIG SGSFGKVYKG RCRNKIVAIK RYRANTYCSK 500
SDVDMFCREV SILCQLNHPC VIQFVGACLN DPSQFAIVTQ YISGGSLFSL 550
LHEQKRILDL QSKLIIAVDV AKGMEYLHNL TQPIIHRDLN SHNILLYEDG 600
HAVVADFGES RFLQSLDEDN MTKQPGNLRW MAPEVFTQCT RYTIKADVFS 650
YALCLWEILT GEIPFAHLKP AAAAADMAYH HIRPPIGYSI PKPISSLLIR 700
GWNACPEGRP EFSEVVMKLE ECLCNIELMS PASSNSSGSL SPSSSSDCLV 750
NRGGPGRSHV AALRSRFELE YALNARSYAA LSQSAGQYSS QGLSLEEMKR 800
SLQYTPIDKY GYVSDPMSSM HFHSCRNSSS FEDSS 835
Length:835
Mass (Da):92,851
Last modified:July 13, 2010 - v3
Checksum:i3B21484B434F46E8
GO
Isoform 1 (identifier: Q59H18-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS

Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein.

Show »
Length:936
Mass (Da):104,179
Checksum:i081220549646863F
GO
Isoform 3 (identifier: Q59H18-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS
     591-596: SHNILL → RYFFPK
     597-835: Missing.

Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein.

Show »
Length:697
Mass (Da):77,957
Checksum:i7567E27D45485C9C
GO
Isoform 4 (identifier: Q59H18-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MGNYKSRPTQTCT → MAAARDPPEV...NSFTILLIHS
     708-742: GRPEFSEVVMKLEECLCNIELMSPASSNSSGSLSP → AKSRPSHYPVSSVYTETLKKKNEDRFGMWIEYLRR
     743-835: Missing.

Note: Based on a naturally occurring readthrough transcript which produces a FPGT-TNNI3K fusion protein.

Show »
Length:843
Mass (Da):94,517
Checksum:i3001399FAEAD7B24
GO

Sequence cautioni

The sequence BAD92178.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence CAE45949.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti151 – 1511D → H.1 Publication
Corresponds to variant rs34874695 [ dbSNP | Ensembl ].
VAR_041223
Natural varianti263 – 2631P → L.1 Publication
Corresponds to variant rs34521608 [ dbSNP | Ensembl ].
VAR_041224
Natural varianti309 – 3091F → L.1 Publication
VAR_041225
Natural varianti430 – 4301S → L in a colorectal adenocarcinoma sample; somatic mutation. 1 Publication
VAR_041226
Natural varianti510 – 5101V → L.1 Publication
Corresponds to variant rs34335537 [ dbSNP | Ensembl ].
VAR_041227
Natural varianti629 – 6291R → G in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_035639
Natural varianti637 – 6371T → M.1 Publication
Corresponds to variant rs2274260 [ dbSNP | Ensembl ].
VAR_041228
Natural varianti686 – 6861I → T.1 Publication
Corresponds to variant rs3737564 [ dbSNP | Ensembl ].
VAR_041229
Natural varianti785 – 7851A → G.1 Publication
Corresponds to variant rs45578635 [ dbSNP | Ensembl ].
VAR_038821
Natural varianti798 – 7981M → I in a head & Neck squamous cell carcinoma sample; somatic mutation. 1 Publication
VAR_041230
Natural varianti833 – 8331D → Y.1 Publication
Corresponds to variant rs45614933 [ dbSNP | Ensembl ].
VAR_038822

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1313MGNYK…TQTCT → MAAARDPPEVSLREATQRKL RRFSELRGKLVARGEFWDIV AITAADEKQELAYNQQLSEK LKRKELPLGVQYHVFVDPAG AKIGNGGSTLCALQCLEKLY GDKWNSFTILLIHS in isoform 1, isoform 3 and isoform 4.
VSP_039403Add
BLAST
Alternative sequencei591 – 5966SHNILL → RYFFPK in isoform 3.
VSP_051882
Alternative sequencei597 – 835239Missing in isoform 3.
VSP_051883Add
BLAST
Alternative sequencei708 – 74235GRPEF…GSLSP → AKSRPSHYPVSSVYTETLKK KNEDRFGMWIEYLRR in isoform 4.
VSP_051884Add
BLAST
Alternative sequencei743 – 83593Missing in isoform 4.
VSP_051885Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti127 – 1271I → V in AAH32865. 1 Publication
Sequence conflicti250 – 2501I → M in CAE45949. 1 Publication
Sequence conflicti367 – 3671N → S in CAE45949. 1 Publication
Sequence conflicti629 – 6291R → L in AAH32865. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF116826 mRNA. Translation: AAD29632.1.
AY303691 mRNA. Translation: AAP72030.1.
AB208941 Transcribed RNA. Translation: BAD92178.1. Different initiation.
BX640903 mRNA. Translation: CAE45949.1. Different initiation.
DQ822519 Genomic DNA. Translation: ABG46944.1.
BX470253
, AC093158, AC098692, AC105271, AC119672 Genomic DNA. Translation: CAI16293.1.
CH471059 Genomic DNA. Translation: EAX06415.1.
BC032865 mRNA. Translation: AAH32865.1.
BC113539 mRNA. Translation: AAI13540.1.
BC117262 mRNA. Translation: AAI17263.1.
CCDSiCCDS664.1. [Q59H18-2]
RefSeqiNP_001186256.2. NM_001199327.1.
NP_057062.1. NM_015978.2. [Q59H18-2]
UniGeneiHs.480085.

Genome annotation databases

EnsembliENST00000326637; ENSP00000322251; ENSG00000116783. [Q59H18-2]
ENST00000370891; ENSP00000359928; ENSG00000116783. [Q59H18-1]
GeneIDi100526835.
51086.
KEGGihsa:100526835.
hsa:51086.
UCSCiuc001dgc.2. human. [Q59H18-3]
uc001dgd.3. human. [Q59H18-4]
uc001dge.2. human. [Q59H18-1]
uc001dgf.2. human. [Q59H18-2]

Polymorphism databases

DMDMi300669705.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF116826 mRNA. Translation: AAD29632.1 .
AY303691 mRNA. Translation: AAP72030.1 .
AB208941 Transcribed RNA. Translation: BAD92178.1 . Different initiation.
BX640903 mRNA. Translation: CAE45949.1 . Different initiation.
DQ822519 Genomic DNA. Translation: ABG46944.1 .
BX470253
, AC093158 , AC098692 , AC105271 , AC119672 Genomic DNA. Translation: CAI16293.1 .
CH471059 Genomic DNA. Translation: EAX06415.1 .
BC032865 mRNA. Translation: AAH32865.1 .
BC113539 mRNA. Translation: AAI13540.1 .
BC117262 mRNA. Translation: AAI17263.1 .
CCDSi CCDS664.1. [Q59H18-2 ]
RefSeqi NP_001186256.2. NM_001199327.1.
NP_057062.1. NM_015978.2. [Q59H18-2 ]
UniGenei Hs.480085.

3D structure databases

ProteinModelPortali Q59H18.
SMRi Q59H18. Positions 41-720.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119276. 8 interactions.
IntActi Q59H18. 7 interactions.

Chemistry

BindingDBi Q59H18.
ChEMBLi CHEMBL5260.
GuidetoPHARMACOLOGYi 2247.

PTM databases

PhosphoSitei Q59H18.

Polymorphism databases

DMDMi 300669705.

Proteomic databases

MaxQBi Q59H18.
PRIDEi Q59H18.

Protocols and materials databases

DNASUi 51086.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000326637 ; ENSP00000322251 ; ENSG00000116783 . [Q59H18-2 ]
ENST00000370891 ; ENSP00000359928 ; ENSG00000116783 . [Q59H18-1 ]
GeneIDi 100526835.
51086.
KEGGi hsa:100526835.
hsa:51086.
UCSCi uc001dgc.2. human. [Q59H18-3 ]
uc001dgd.3. human. [Q59H18-4 ]
uc001dge.2. human. [Q59H18-1 ]
uc001dgf.2. human. [Q59H18-2 ]

Organism-specific databases

CTDi 100526835.
51086.
GeneCardsi GC01P074669.
HGNCi HGNC:19661. TNNI3K.
MIMi 613932. gene.
neXtProti NX_Q59H18.
PharmGKBi PA134976654.
GenAtlasi Search...

Phylogenomic databases

HOGENOMi HOG000234421.
HOVERGENi HBG079513.
InParanoidi Q59H18.
KOi K17535.
OMAi QPHVVNI.
OrthoDBi EOG7XDBF3.
PhylomeDBi Q59H18.

Miscellaneous databases

NextBioi 53751.
PROi Q59H18.
SOURCEi Search...

Gene expression databases

Bgeei Q59H18.
CleanExi HS_TNNI3K.
Genevestigatori Q59H18.

Family and domain databases

Gene3Di 1.25.40.20. 3 hits.
InterProi IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR001245. Ser-Thr/Tyr_kinase_cat_dom.
[Graphical view ]
Pfami PF12796. Ank_2. 3 hits.
PF07714. Pkinase_Tyr. 1 hit.
[Graphical view ]
PRINTSi PR01415. ANKYRIN.
SMARTi SM00248. ANK. 10 hits.
[Graphical view ]
SUPFAMi SSF48403. SSF48403. 1 hit.
SSF56112. SSF56112. 1 hit.
PROSITEi PS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 6 hits.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel cardiac-specific kinase that interacts specifically with cardiac troponin I."
    Zhao Y., Meng X.-M., Wei Y.-J., Zhao X.-W., Liu D.-Q., Cao H.-Q., Liew C.-C., Ding J.-F.
    J. Mol. Med. 81:297-304(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, AUTOPHOSPHORYLATION, INTERACTION WITH TNNI3; ACTC; ACTA1; MYBPC3; AIP; BABP3 AND HADHB, MUTAGENESIS OF LYS-490.
    Tissue: Heart.
  2. "Cardiac ankyrin repeat kinase (CARK)."
    Jeyaseelan R.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  3. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Fetal kidney.
  5. SeattleSNPs variation discovery resource
    Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS GLY-785 AND TYR-833.
  6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Tissue: Brain.
  9. Cited for: VARIANT [LARGE SCALE ANALYSIS] GLY-629.
  10. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] HIS-151; LEU-263; LEU-309; LEU-430; LEU-510; MET-637; THR-686 AND ILE-798.

Entry informationi

Entry nameiTNI3K_HUMAN
AccessioniPrimary (citable) accession number: Q59H18
Secondary accession number(s): Q17RN0
, Q49AR1, Q6MZS9, Q9Y2V6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: July 13, 2010
Last modified: July 9, 2014
This is version 112 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi