Q59E36 (RCOR_DROME) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 86.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: REST corepressor Alternative name(s): CoREST | ||||
| Gene names |
| ||||
| Organism | Drosophila melanogaster (Fruit fly) [Reference proteome] | ||||
| Taxonomic identifier | 7227 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Ecdysozoa › Arthropoda › Hexapoda › Insecta › Pterygota › Neoptera › Endopterygota › Diptera › Brachycera › Muscomorpha › Ephydroidea › Drosophilidae › Drosophila › Sophophora › ![]() |
Protein attributes
| Sequence length | 657 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Essential component of a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited by Ttk88 and probably acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. May serve as a molecular beacon for the recruitment of molecular machinery that imposes silencing across a chromosomal interval. Ref.5 |
| Subunit structure | Component of a complex that contains at least Rpd3, CoRest and Su(var)3-3/Hdm. Interacts with neuronal repressor ttk/Ttk88. Ref.5 |
| Subcellular location | |
| Tissue specificity | Present in all of the tissues examined including both glia and neurons of the CNS (at protein level). Expressed ubiquitously in the embryo. In contrast, expression of isoform 3 is highly enriched in the nervous system. Ref.5 |
| Sequence similarities | Belongs to the CoREST family. Contains 1 ELM2 domain. Contains 2 SANT domains. |
| Sequence caution | The sequence AAL25265.1 differs from that shown. Reason: Erroneous initiation. The sequence AAM49876.1 differs from that shown. Reason: Erroneous initiation. The sequence AAX52508.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q59E36-1) Also known as: F; dCRL; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q59E36-2) Also known as: E; The sequence of this isoform differs from the canonical sequence as follows: 265-333: SKPLQTADANTAIGRRTGNRRPISGPEGNRKPPKGMYINHDDLTALASCGNPSLYLAERERKLTALMAE → IQ | ||||||
| Isoform 3 (identifier: Q59E36-3) Also known as: A; C; D; dCRS; The sequence of this isoform differs from the canonical sequence as follows: 265-273: SKPLQTADA → IIAVPAHIS 274-657: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 657 | 657 | REST corepressor | PRO_0000226784 | |||||
Regions | |||||||||
| Domain | 90 – 175 | 86 | ELM2 | ||||||
| Domain | 176 – 227 | 52 | SANT 1 | ||||||
| Domain | 369 – 420 | 52 | SANT 2 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 18 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 22 | 1 | Phosphoserine Ref.6 Ref.7 | ||||||
| Modified residue | 25 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 34 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 36 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 65 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 68 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 69 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 442 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 478 | 1 | Phosphothreonine Ref.7 | ||||||
| Modified residue | 481 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 627 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 265 – 333 | 69 | SKPLQ…ALMAE → IQ in isoform 2. | VSP_017465 | |||||
| Alternative sequence | 265 – 273 | 9 | SKPLQTADA → IIAVPAHIS in isoform 3. | VSP_017466 | |||||
| Alternative sequence | 274 – 657 | 384 | Missing in isoform 3. | VSP_017467 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The genome sequence of Drosophila melanogaster." Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D., Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F., George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N., Sutton G.G., Wortman J.R., Yandell M.D. Venter J.C.Science 287:2185-2195(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Berkeley. |
| [2] | "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review." Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S., Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E., Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P., Bettencourt B.R., Celniker S.E., de Grey A.D.N.J. Lewis S.E.Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002) [PubMed] [Europe PMC] [Abstract] Cited for: GENOME REANNOTATION, ALTERNATIVE SPLICING. Strain: Berkeley. |
| [3] | Stapleton M., Carlson J.W., Chavez C., Frise E., George R.A., Pacleb J.M., Park S., Wan K.H., Yu C., Celniker S.E. Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: Berkeley. Tissue: Embryo. |
| [4] | "A Drosophila full-length cDNA resource." Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M., George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H., Rubin G.M., Celniker S.E. Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 65-657 (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 334-657 (ISOFORM 1/2). Strain: Berkeley. Tissue: Embryo and Head. |
| [5] | "A conserved role but different partners for the transcriptional corepressor CoREST in fly and mammalian nervous system formation." Dallman J.E., Allopenna J., Bassett A., Travers A., Mandel G. J. Neurosci. 24:7186-7193(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY, INTERACTION WITH TTK; RPD3 AND SU(VAR)3-3. |
| [6] | "An integrated chemical, mass spectrometric and computational strategy for (quantitative) phosphoproteomics: application to Drosophila melanogaster Kc167 cells." Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D., Juenger M.A., Eng J.K., Aebersold R., Tao W.A. Mol. Biosyst. 3:275-286(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-22; SER-34; SER-36 AND SER-627, MASS SPECTROMETRY. |
| [7] | "Phosphoproteome analysis of Drosophila melanogaster embryos." Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P. J. Proteome Res. 7:1675-1682(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-18; SER-22; THR-25; THR-65; SER-68; SER-69; THR-442; THR-478 AND SER-481, MASS SPECTROMETRY. Tissue: Embryo. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AE014298 Genomic DNA. Translation: AAF48966.1. AE014298 Genomic DNA. Translation: AAN09497.1. AE014298 Genomic DNA. Translation: AAN09498.1. AE014298 Genomic DNA. Translation: AAX52507.1. AE014298 Genomic DNA. Translation: AAX52508.1. Sequence problems. BT023817 mRNA. Translation: AAZ66324.1. AY060226 mRNA. Translation: AAL25265.1. Different initiation. AY118507 mRNA. Translation: AAM49876.1. Different initiation. |
| RefSeq | NP_001014752.2. NM_001014752.4. NP_001014753.1. NM_001014753.3. NP_001014754.1. NM_001014754.1. NP_001014755.1. NM_001014755.2. NP_001014756.1. NM_001014756.2. |
| UniGene | Dm.4085. |
3D structure databases | |
| ProteinModelPortal | Q59E36. |
| SMR | Q59E36. Positions 179-225, 294-430. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q59E36. 2 interactions. |
| MINT | MINT-1651349. |
Proteomic databases | |
| PaxDb | Q59E36. |
| PRIDE | Q59E36. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 32941. |
| KEGG | dme:Dmel_CG42687. |
| UCSC | CG33525-RA. d. melanogaster. |
Organism-specific databases | |
| CTD | 32941. |
| FlyBase | FBgn0261573. CoRest. |
Phylogenomic databases | |
| eggNOG | NOG326181. |
| InParanoid | Q59E36. |
| OrthoDB | EOG46DJJD. |
| PhylomeDB | Q59E36. |
Gene expression databases | |
| GermOnline | CG33525. Drosophila melanogaster. |
Family and domain databases | |
| InterPro | IPR000949. ELM2_dom. IPR009057. Homeodomain-like. IPR001005. SANT/Myb. IPR017884. SANT_dom. [Graphical view] |
| Pfam | PF01448. ELM2. 1 hit. [Graphical view] |
| SMART | SM00717. SANT. 2 hits. [Graphical view] |
| SUPFAM | SSF46689. Homeodomain_like. 2 hits. |
| PROSITE | PS51156. ELM2. 1 hit. PS51293. SANT. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 32941. |
| NextBio | 781152. |
Entry information
| Entry name | RCOR_DROME | ||||||||
| Accession | Primary (citable) accession number: Q59E36 Secondary accession number(s): A4V4S3 Q9VWH3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Drosophila annotation project | ||||||||
Relevant documents
| Drosophila Drosophila: entries, gene names and cross-references to FlyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with
