Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DEP domain-containing mTOR-interacting protein

Gene

Deptor

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Negative regulator of the mTORC1 and mTORC2 signaling pathways. Inhibits the kinase activity of both complexes (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
DEP domain-containing mTOR-interacting protein
Alternative name(s):
DEP domain-containing protein 6
Gene namesi
Name:Deptor
Synonyms:Depdc6, Kiaa4200
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:2146322. Deptor.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 409409DEP domain-containing mTOR-interacting proteinPRO_0000284785Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei241 – 2411PhosphothreonineBy similarity
Modified residuei244 – 2441PhosphoserineCombined sources
Modified residuei258 – 2581PhosphoserineBy similarity
Modified residuei259 – 2591PhosphothreonineBy similarity
Modified residuei263 – 2631PhosphoserineBy similarity
Modified residuei265 – 2651PhosphoserineCombined sources
Modified residuei280 – 2801PhosphoserineCombined sources
Modified residuei282 – 2821PhosphoserineBy similarity
Modified residuei283 – 2831PhosphoserineBy similarity
Modified residuei287 – 2871PhosphoserineBy similarity
Modified residuei293 – 2931PhosphoserineCombined sources
Modified residuei297 – 2971PhosphoserineBy similarity
Modified residuei298 – 2981PhosphoserineBy similarity
Modified residuei299 – 2991PhosphoserineBy similarity

Post-translational modificationi

Phosphorylation weakens interaction with MTOR within mTORC1 and mTORC2.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ570Y9.
PaxDbiQ570Y9.
PRIDEiQ570Y9.

PTM databases

iPTMnetiQ570Y9.
PhosphoSiteiQ570Y9.

Expressioni

Gene expression databases

BgeeiENSMUSG00000022419.
CleanExiMM_DEPDC6.
ExpressionAtlasiQ570Y9. baseline and differential.
GenevisibleiQ570Y9. MM.

Interactioni

Subunit structurei

Part of the mammalian target of rapamycin complex 1 (mTORC1) which contains MTOR, MLST8, RPTOR, AKT1S1/PRAS40 and DEPTOR. Part of the mammalian target of rapamycin complex 2 (mTORC2) which contains MTOR, MLST8, PROTOR1, RICTOR, MAPKAP1 and DEPTOR. Interacts (via PDZ domain) with MTOR; interacts with MTOR within both mammalian target of rapamycin complexes mTORC1 and mTORC2 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000094167.

Structurei

3D structure databases

ProteinModelPortaliQ570Y9.
SMRiQ570Y9. Positions 32-121, 336-404.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini36 – 11984DEP 1PROSITE-ProRule annotationAdd
BLAST
Domaini146 – 21974DEP 2PROSITE-ProRule annotationAdd
BLAST
Domaini330 – 40778PDZPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi235 – 29965Ser-richAdd
BLAST

Sequence similaritiesi

Contains 2 DEP domains.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IKSC. Eukaryota.
ENOG4110T1J. LUCA.
GeneTreeiENSGT00520000055667.
HOVERGENiHBG056008.
InParanoidiQ570Y9.
OMAiRIYEKLM.
OrthoDBiEOG091G0AB3.
PhylomeDBiQ570Y9.

Family and domain databases

Gene3Di1.10.10.10. 2 hits.
2.30.42.10. 1 hit.
InterProiIPR000591. DEP_dom.
IPR001478. PDZ.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00610. DEP. 2 hits.
[Graphical view]
SMARTiSM00049. DEP. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 2 hits.
SSF50156. SSF50156. 1 hit.
PROSITEiPS50186. DEP. 2 hits.
PS50106. PDZ. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q570Y9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEEGSSGGSG SSDSNAGGSG GVQQRELERM AEVLVTGEQL RLRLHEEKVI
60 70 80 90 100
KDRRHHLKTY PNCFVAKELI DWLIEHKEAS DRETAIKLMQ KLADRGIIHH
110 120 130 140 150
VCDEHKEFKD VKLFYRFRKD DGTFALDSEV KAFMRGQRLY EKLMSPETTL
160 170 180 190 200
LQPREEEGVK YERTFMASEF LDWLVQEGEA TTRKEAEQLC HRLMDHGIIQ
210 220 230 240 250
HVSNKHPFVD SNLLYQFRMN FRRRRRLMEL LNETSPSSQE THDSPFCLRK
260 270 280 290 300
QSHDSRKSTS FMSVSPSKEI KIVSAVRRSS MSSCGSSGYF SSSPTLSSSP
310 320 330 340 350
PVLCNPKSVL KRPVTSEELL TPGAPYARKT FTIVGDAVGW GFVVRGSKPC
360 370 380 390 400
HIQAVDPSGP AAAAGMKVCQ FVVSVNGLNV LNVDYRTVSN LILTGPRTIV

MEVMEELDC
Length:409
Mass (Da):46,120
Last modified:April 17, 2007 - v2
Checksum:i072062418DADDF8E
GO
Isoform 2 (identifier: Q570Y9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MEEGSSGGSGSSDSNAGGSGGVQQRELERMAEVLVTGEQL → MKQAFLVVLRHSISEDRLPPLSVITSGC

Note: No experimental confirmation available.
Show »
Length:397
Mass (Da):45,233
Checksum:i2F65AF24F475B601
GO
Isoform 3 (identifier: Q570Y9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     368-409: VCQFVVSVNG...VMEVMEELDC → DTGTESRKIVTSRLAWATWQDLMGGKVGGDAIPI

Note: No experimental confirmation available.
Show »
Length:401
Mass (Da):45,066
Checksum:iE502ECF5C3615B97
GO

Sequence cautioni

The sequence BAD90225 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti11 – 111S → G in BAE26298 (PubMed:16141072).Curated
Sequence conflicti125 – 1251A → P in BAE26298 (PubMed:16141072).Curated
Sequence conflicti128 – 1281S → N in BAE26298 (PubMed:16141072).Curated
Sequence conflicti149 – 1491T → I in BAE26298 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4040MEEGS…TGEQL → MKQAFLVVLRHSISEDRLPP LSVITSGC in isoform 2. 1 PublicationVSP_024648Add
BLAST
Alternative sequencei368 – 40942VCQFV…EELDC → DTGTESRKIVTSRLAWATWQ DLMGGKVGGDAIPI in isoform 3. 1 PublicationVSP_024649Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK220300 mRNA. Translation: BAD90225.1. Different initiation.
AK139888 mRNA. Translation: BAE24172.1.
AK145208 mRNA. Translation: BAE26298.1.
CCDSiCCDS27474.1. [Q570Y9-1]
CCDS27475.1. [Q570Y9-2]
RefSeqiNP_001033026.1. NM_001037937.3. [Q570Y9-2]
NP_663445.2. NM_145470.3. [Q570Y9-1]
UniGeneiMm.295397.
Mm.393497.

Genome annotation databases

EnsembliENSMUST00000023056; ENSMUSP00000023056; ENSMUSG00000022419. [Q570Y9-2]
ENSMUST00000096433; ENSMUSP00000094167; ENSMUSG00000022419. [Q570Y9-1]
GeneIDi97998.
KEGGimmu:97998.
UCSCiuc007vsb.2. mouse. [Q570Y9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK220300 mRNA. Translation: BAD90225.1. Different initiation.
AK139888 mRNA. Translation: BAE24172.1.
AK145208 mRNA. Translation: BAE26298.1.
CCDSiCCDS27474.1. [Q570Y9-1]
CCDS27475.1. [Q570Y9-2]
RefSeqiNP_001033026.1. NM_001037937.3. [Q570Y9-2]
NP_663445.2. NM_145470.3. [Q570Y9-1]
UniGeneiMm.295397.
Mm.393497.

3D structure databases

ProteinModelPortaliQ570Y9.
SMRiQ570Y9. Positions 32-121, 336-404.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000094167.

PTM databases

iPTMnetiQ570Y9.
PhosphoSiteiQ570Y9.

Proteomic databases

MaxQBiQ570Y9.
PaxDbiQ570Y9.
PRIDEiQ570Y9.

Protocols and materials databases

DNASUi97998.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000023056; ENSMUSP00000023056; ENSMUSG00000022419. [Q570Y9-2]
ENSMUST00000096433; ENSMUSP00000094167; ENSMUSG00000022419. [Q570Y9-1]
GeneIDi97998.
KEGGimmu:97998.
UCSCiuc007vsb.2. mouse. [Q570Y9-1]

Organism-specific databases

CTDi64798.
MGIiMGI:2146322. Deptor.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IKSC. Eukaryota.
ENOG4110T1J. LUCA.
GeneTreeiENSGT00520000055667.
HOVERGENiHBG056008.
InParanoidiQ570Y9.
OMAiRIYEKLM.
OrthoDBiEOG091G0AB3.
PhylomeDBiQ570Y9.

Miscellaneous databases

ChiTaRSiDeptor. mouse.
PROiQ570Y9.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000022419.
CleanExiMM_DEPDC6.
ExpressionAtlasiQ570Y9. baseline and differential.
GenevisibleiQ570Y9. MM.

Family and domain databases

Gene3Di1.10.10.10. 2 hits.
2.30.42.10. 1 hit.
InterProiIPR000591. DEP_dom.
IPR001478. PDZ.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF00610. DEP. 2 hits.
[Graphical view]
SMARTiSM00049. DEP. 2 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 2 hits.
SSF50156. SSF50156. 1 hit.
PROSITEiPS50186. DEP. 2 hits.
PS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDPTOR_MOUSE
AccessioniPrimary (citable) accession number: Q570Y9
Secondary accession number(s): Q3UM00, Q3UT08
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 17, 2007
Last modified: September 7, 2016
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.