Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1

Gene

Smarce1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Required for the coactivation of estrogen responsive promoters by Swi/Snf complexes and the SRC/p160 family of histone acetyltransferases (HATs). Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi31 – 99HMG boxPROSITE-ProRule annotationAdd BLAST69

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • protein N-terminus binding Source: RGD

GO - Biological processi

  • ATP-dependent chromatin remodeling Source: InterPro
  • brain development Source: RGD
  • chromatin modification Source: UniProtKB-KW
  • negative regulation of transcription, DNA-templated Source: RGD
  • spermatid development Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator

Keywords - Biological processi

Neurogenesis

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
Alternative name(s):
BRG1-associated factor 57
Short name:
BAF57
Gene namesi
Name:Smarce1
Synonyms:Baf57
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi1304726. Smarce1.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

  • nucleus Source: RGD
  • SWI/SNF complex Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004204771 – 376SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1Add BLAST376

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei4Omega-N-methylarginineBy similarity1
Cross-linki57Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)By similarity
Cross-linki57Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki111Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei230PhosphoserineBy similarity1

Post-translational modificationi

Ubiquitinated by TRIP12, leading to its degradation by the proteasome. Ubiquitination is prevented upon interaction between TRIP12 and SMARCC1 (By similarity).By similarity

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ56A18.
PeptideAtlasiQ56A18.
PRIDEiQ56A18.

PTM databases

iPTMnetiQ56A18.
PhosphoSitePlusiQ56A18.

Interactioni

Subunit structurei

Component of a number of multiprotein chromatin-remodeling complexes: Swi/Snf-A (BAF), Swi/Snf-B (PBAF), Brm, Brg1(I) and Brg1(II). Each of the complexes contains a catalytic subunit (either SMARCA4/BRG1/BAF190A or SMARCA2/BRM/BAF190B), and at least SMARCE1, ACTL6A/BAF53, SMARCC1/BAF155, SMARCC2/BAF170, and SMARCB1 (SNF5/INI1). Other subunits specific to each of the complexes may also be present. Component of the BAF complex, which includes at least actin (ACTB), ARID1A, ARID1B/BAF250, SMARCA2, SMARCA4/BRG1/BAF190A, ACTL6A/BAF53, ACTL6B/BAF53B, SMARCE1/BAF57, SMARCC1/BAF155, SMARCC2/BAF170, SMARCB1/SNF5/INI1, and one or more of SMARCD1/BAF60A, SMARCD2/BAF60B, or SMARCD3/BAF60C. In muscle cells, the BAF complex also contains DPF3. Also binds to the SRC/p160 family of histone acetyltransferases (HATs) composed of NCOA1, NCOA2, and NCOA3. NCOA3. Interacts with RCOR1/CoREST, NR3C1 and ZMIM2/ZIMP7. Component of neural progenitors-specific chromatin remodeling complex (npBAF complex) composed of at least, ARID1A/BAF250A or ARID1B/BAF250B, SMARCD1/BAF60A, SMARCD3/BAF60C, SMARCA2/BRM/BAF190B, SMARCA4/BRG1/BAF190A, SMARCB1/BAF47, SMARCC1/BAF155, SMARCE1/BAF57, SMARCC2/BAF170, PHF10/BAF45A, ACTL6A/BAF53A and actin. Component of neuron-specific chromatin remodeling complex (nBAF complex) composed of at least, ARID1A/BAF250A or ARID1B/BAF250B, SMARCD1/BAF60A, SMARCD3/BAF60C, SMARCA2/BRM/BAF190B, SMARCA4/BRG1/BAF190A, SMARCB1/BAF47, SMARCC1/BAF155, SMARCE1/BAF57, SMARCC2/BAF170, DPF1/BAF45B, DPF3/BAF45C, ACTL6B/BAF53B and actin (By similarity). Interacts with BRDT.By similarity1 Publication

GO - Molecular functioni

  • protein N-terminus binding Source: RGD

Protein-protein interaction databases

BioGridi257563. 1 interactor.
STRINGi10116.ENSRNOP00000014230.

Structurei

3D structure databases

ProteinModelPortaliQ56A18.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili187 – 283Sequence analysisAdd BLAST97

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi207 – 376Glu-richAdd BLAST170

Domaini

The HMG domain is essential for CD4 silencing and CD8 activation; mutation of this domain blocks thymus development.

Sequence similaritiesi

Contains 1 HMG box DNA-binding domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG4715. Eukaryota.
ENOG410Y9B3. LUCA.
HOGENOMiHOG000230965.
HOVERGENiHBG054558.
InParanoidiQ56A18.
KOiK11651.

Family and domain databases

Gene3Di1.10.30.10. 1 hit.
InterProiIPR030089. BAF57.
IPR009071. HMG_box_dom.
[Graphical view]
PANTHERiPTHR13711:SF206. PTHR13711:SF206. 1 hit.
PfamiPF00505. HMG_box. 1 hit.
[Graphical view]
SMARTiSM00398. HMG. 1 hit.
[Graphical view]
SUPFAMiSSF47095. SSF47095. 1 hit.
PROSITEiPS50118. HMG_BOX_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q56A18-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSKRPSYAPP PTPAPATASS GITIPKPPKP PDKPLMPYMR YSRKVWDQVK
60 70 80 90 100
ASNPDLKLWE IGKIIGGMWR DLTDEEKQEY LNEYEAEKIE YNESMKAYHN
110 120 130 140 150
SPAYLAYINA KSRAEAALEE ESRQRQSRME KGEPYMSIQP AEDPDDYDDG
160 170 180 190 200
FSMKHTATAR FQRNHRLISE ILSESVVPDV RSVVTTARMQ VLKRQVQSLM
210 220 230 240 250
VHQRKLEAEL LQIEERHQEK KRKFLESTDS FNNELKRLCG LKVEVDMEKI
260 270 280 290 300
AAEIAQAEEQ ARKRQEEREK EAAEQAERSQ GSIAPEEEQV ANKAEEKKDE
310 320 330 340 350
ENIPMETEET HLEDTAENQQ NGEEGTSTPE DKESGQEGVD SMEVEGTSDS
360 370
NTGSESNSAT VEEPPTDPVP EDEKKE
Length:376
Mass (Da):42,831
Last modified:May 10, 2005 - v1
Checksum:iA66CBB2492711C1E
GO
Isoform 2 (identifier: Q56A18-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: Missing.
     234-235: Missing.

Note: No experimental confirmation available.
Show »
Length:307
Mass (Da):35,250
Checksum:i12E5A9D02126FE5D
GO
Isoform 3 (identifier: Q56A18-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: Missing.

Show »
Length:341
Mass (Da):39,255
Checksum:iBC6E5C7C4E9CEDAF
GO
Isoform 4 (identifier: Q56A18-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: MSKRPSYAPPPTPAPA → MPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRV

Show »
Length:393
Mass (Da):44,765
Checksum:iC82E63DBDBFBA8E7
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0445131 – 67Missing in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0445141 – 35Missing in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0445151 – 16MSKRP…TPAPA → MPSTPGFVGYNPYSHLAYNN YRLGGNPGTNSRV in isoform 4. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_044516234 – 235Missing in isoform 2. 1 Publication2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC091314 mRNA. Translation: AAH91314.1.
BC092210 mRNA. Translation: AAH92210.1.
EU327027 mRNA. Translation: ACA81401.1.
EU327028 mRNA. Translation: ACA81402.1.
EU327029 mRNA. Translation: ACA81403.1.
EU327030 mRNA. Translation: ACA81404.1.
EU327031 mRNA. Translation: ACA81405.1.
RefSeqiNP_001020164.1. NM_001024993.1. [Q56A18-1]
UniGeneiRn.8513.

Genome annotation databases

GeneIDi303518.
KEGGirno:303518.
UCSCiRGD:1304726. rat.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC091314 mRNA. Translation: AAH91314.1.
BC092210 mRNA. Translation: AAH92210.1.
EU327027 mRNA. Translation: ACA81401.1.
EU327028 mRNA. Translation: ACA81402.1.
EU327029 mRNA. Translation: ACA81403.1.
EU327030 mRNA. Translation: ACA81404.1.
EU327031 mRNA. Translation: ACA81405.1.
RefSeqiNP_001020164.1. NM_001024993.1. [Q56A18-1]
UniGeneiRn.8513.

3D structure databases

ProteinModelPortaliQ56A18.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi257563. 1 interactor.
STRINGi10116.ENSRNOP00000014230.

PTM databases

iPTMnetiQ56A18.
PhosphoSitePlusiQ56A18.

Proteomic databases

PaxDbiQ56A18.
PeptideAtlasiQ56A18.
PRIDEiQ56A18.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi303518.
KEGGirno:303518.
UCSCiRGD:1304726. rat.

Organism-specific databases

CTDi6605.
RGDi1304726. Smarce1.

Phylogenomic databases

eggNOGiKOG4715. Eukaryota.
ENOG410Y9B3. LUCA.
HOGENOMiHOG000230965.
HOVERGENiHBG054558.
InParanoidiQ56A18.
KOiK11651.

Miscellaneous databases

PROiQ56A18.

Family and domain databases

Gene3Di1.10.30.10. 1 hit.
InterProiIPR030089. BAF57.
IPR009071. HMG_box_dom.
[Graphical view]
PANTHERiPTHR13711:SF206. PTHR13711:SF206. 1 hit.
PfamiPF00505. HMG_box. 1 hit.
[Graphical view]
SMARTiSM00398. HMG. 1 hit.
[Graphical view]
SUPFAMiSSF47095. SSF47095. 1 hit.
PROSITEiPS50118. HMG_BOX_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSMCE1_RAT
AccessioniPrimary (citable) accession number: Q56A18
Secondary accession number(s): C0IMX4
, C0IMX5, C0IMX6, Q5BJV2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2012
Last sequence update: May 10, 2005
Last modified: November 30, 2016
This is version 80 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.