Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 608

Gene

Znf608

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Transcription factor, which represses ZNF609 transcription.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri552 – 577C2H2-typeAdd BLAST26

GO - Molecular functioni

GO - Biological processi

  • negative regulation of T cell differentiation in thymus Source: UniProtKB
  • negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 608
Gene namesi
Name:Znf608
Synonyms:Kiaa1281, Zfp608
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 18

Organism-specific databases

MGIiMGI:2442338. Zfp608.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002804211 – 1511Zinc finger protein 608Add BLAST1511

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki282Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei420PhosphoserineCombined sources1
Modified residuei423PhosphoserineCombined sources1
Modified residuei480PhosphothreonineCombined sources1
Modified residuei492PhosphoserineCombined sources1
Modified residuei626PhosphoserineCombined sources1
Modified residuei781PhosphoserineCombined sources1
Cross-linki879Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei894PhosphoserineBy similarity1
Modified residuei963PhosphoserineBy similarity1
Modified residuei1097PhosphoserineBy similarity1
Cross-linki1117Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1175Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1181Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1198Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1215Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1233Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1249Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1291Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1309Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1413Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ56A10.
PeptideAtlasiQ56A10.
PRIDEiQ56A10.

PTM databases

iPTMnetiQ56A10.
PhosphoSitePlusiQ56A10.

Expressioni

Tissue specificityi

Expressed at low levels in thymocytes.1 Publication

Gene expression databases

BgeeiENSMUSG00000052713.
CleanExiMM_ZFP608.
ExpressionAtlasiQ56A10. baseline and differential.
GenevisibleiQ56A10. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000068192.

Structurei

3D structure databases

ProteinModelPortaliQ56A10.
SMRiQ56A10.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili277 – 303Sequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi140 – 263Gly-richAdd BLAST124
Compositional biasi309 – 314Poly-Pro6
Compositional biasi440 – 443Poly-Ala4

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri552 – 577C2H2-typeAdd BLAST26

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiENOG410IIE1. Eukaryota.
ENOG410Z79M. LUCA.
GeneTreeiENSGT00390000008748.
HOGENOMiHOG000082539.
HOVERGENiHBG054557.
InParanoidiQ56A10.
OMAiLMHSYPG.
OrthoDBiEOG091G00Q9.
PhylomeDBiQ56A10.
TreeFamiTF329775.

Family and domain databases

InterProiView protein in InterPro
IPR013087. Znf_C2H2_type.
PROSITEiView protein in PROSITE
PS00028. ZINC_FINGER_C2H2_1. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q56A10-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVNVSTAGK GVDPNTVDTY DSGDDWEIGV GNLIIDLDAD LEKDRQKFEM
60 70 80 90 100
NNSTNTTTNT TKDCGGPASN GTCSTSALAD GLKFASVQPS APQGNSHKET
110 120 130 140 150
SKSKVKRAKT SKDANKSLPS AALYGIPEIS STGKRQEVQG RPGEATGMNS
160 170 180 190 200
ALGQSVSGGG SSNPNSNGTS TGTSAATAGA GSCGKSKEEK PGKSHSSRGA
210 220 230 240 250
KRDKDAARSR KEKHDLLQGH QNGGGGQAPS GGHLYGFGTK SNGSGASPFH
260 270 280 290 300
CGGAGSGSVG AAGEVSKTAP DSTLMGNSML VKKEEEEEES HRRIKKLKTE
310 320 330 340 350
KVDPLFTVPA PPPPIASSLA PQIPPSYFPP SSSNIAAPVE QLLVRTRSVG
360 370 380 390 400
VNTCEVGVVT EPECLGPCEP GTSVNLEGIV WHETEEGVLV VNVTWRNKTY
410 420 430 440 450
VGTLLDCTKH DWAPPRFCES PTSDLEMRGG RGRGKRARSA AAAPGSEVSF
460 470 480 490 500
TESRGLQSKN RGGANGKGRR GSLNASGRRT PPNCAAEDIK ASPSSTNKRK
510 520 530 540 550
NKPPMELDLN SSSEDSKPGK RVRTNSRSTP TTPQGKPETT FLDQGCSSPV
560 570 580 590 600
LIDCPHPNCN KKYKHINGLR YHQAHAHLDP ENKLEFEPDS EDKISDCEEA
610 620 630 640 650
LSNVALECNE SSTSVSSYDQ TKAPGSPGAG NPPGTPKGKR EHVSNGPGPI
660 670 680 690 700
IGSKTGKNSG KKRGLNNELN NLPVISNMTA ALDICSATDS NLTAEMPKLE
710 720 730 740 750
AEGLIDKKSL GDKEKGKKAN NCKMDKNLSK LKSARPIAPA PAPTPPQLIA
760 770 780 790 800
IPTAAFTSTT TGTIPGLPSL TTTVVQATPK SPPLKPIQPK PTIMGEPITV
810 820 830 840 850
NPALVSLKDR KKKEKRKLKD KEGKETGGPK MDAKLGKLEE AKAASKDLSG
860 870 880 890 900
HFLKDHLGKS EGLANGLSES QESRMASIKA EADKVYTFTD NAPSPSIGSA
910 920 930 940 950
SRMECSTLVN GQAPMAPLHV LTQNGAESAA AKTSSPAYSD ISDAADDGGS
960 970 980 990 1000
DSRSEGMRSK ASSPSDTFSN KDGVVKGHPS TSAQPSQLKE SHSPYYHGYE
1010 1020 1030 1040 1050
PYYSPSYMHP GQVGAPAAGN GGSTQGMKIK KESEEDAEKK DKAEQLESKK
1060 1070 1080 1090 1100
VDHTSAPLQP QHQSVITQRH PALAQSLYYG QYAYGLYMDQ KSLMATSPAY
1110 1120 1130 1140 1150
RQQYEKYYED QRLAEQKMAQ SGRGDCERKA ELPLKELGKE DNKQKNMPSA
1160 1170 1180 1190 1200
TISKAPSTPE PNKNHSKLGP SVPNKTEETG KSQLLSSHQQ QLQADSFKAK
1210 1220 1230 1240 1250
QMENHQLIKE AVEMKSVMDS MKQTGVDPTS RFKQDPESRT WHHYVYQPKY
1260 1270 1280 1290 1300
LDQQKPEELD REKKLKEDSP RKTPNKESGV SSLPVSLTNI KEEPKEGKRP
1310 1320 1330 1340 1350
DSQSVEENKL KNDDRKTPVN WKDSRGTRVA VSSPMSQHQS YIQYLHAYPY
1360 1370 1380 1390 1400
PQMYDPSHPA YRAVSPVLMH SYPGAYLSPG FHYPVYGKMS GREEAEKVNT
1410 1420 1430 1440 1450
SPSINTKTAS EAKALDLLQH HANQYRSKSP APVEKASTER EREAERERDR
1460 1470 1480 1490 1500
HSPFSQRHLH THHHTHVGMG YPLIPGQYDP FQGLTSAALV ASQQVAAQAS
1510
ASGMFPAQRR E
Length:1,511
Mass (Da):162,345
Last modified:May 10, 2005 - v1
Checksum:i4331F1298053D5AC
GO
Isoform 2 (identifier: Q56A10-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1432-1455: PVEKASTEREREAERERDRHSPFS → VSLLLLVVKRPCLVGEGRQETEQS
     1456-1511: Missing.

Note: No experimental confirmation available.
Show »
Length:1,455
Mass (Da):156,027
Checksum:iF8CD6B9F2933AF91
GO
Isoform 3 (identifier: Q56A10-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     388-423: VLVVNVTWRNKTYVGTLLDCTKHDWAPPRFCESPTS → KYVLFLFISLCPLLHDVSLSICEGNLFSLWFERIER
     424-1511: Missing.

Note: No experimental confirmation available.
Show »
Length:423
Mass (Da):43,963
Checksum:i0A66BDA7F4AFE304
GO

Sequence cautioni

The sequence BAC36234 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti931 – 932AK → PN in BAC36234 (PubMed:16141072).Curated2
Sequence conflicti987Q → H in BAC36234 (PubMed:16141072).Curated1
Sequence conflicti1039K → N in BAC36234 (PubMed:16141072).Curated1
Sequence conflicti1436A → G in BAC36234 (PubMed:16141072).Curated1
Sequence conflicti1449D → G in BAC36234 (PubMed:16141072).Curated1
Sequence conflicti1490V → G in BAC36234 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_023665388 – 423VLVVN…ESPTS → KYVLFLFISLCPLLHDVSLS ICEGNLFSLWFERIER in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_023666424 – 1511Missing in isoform 3. 1 PublicationAdd BLAST1088
Alternative sequenceiVSP_0236671432 – 1455PVEKA…HSPFS → VSLLLLVVKRPCLVGEGRQE TEQS in isoform 2. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_0236681456 – 1511Missing in isoform 2. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK047979 mRNA. Translation: BAC33204.1.
AK076178 mRNA. Translation: BAC36234.1. Different initiation.
BC092219 mRNA. Translation: AAH92219.1.
AK129321 mRNA. Translation: BAC98131.1.
CCDSiCCDS37824.1. [Q56A10-1]
RefSeqiNP_786927.2. NM_175751.4. [Q56A10-1]
XP_006526020.1. XM_006525957.3. [Q56A10-1]
UniGeneiMm.192984.
Mm.471753.

Genome annotation databases

EnsembliENSMUST00000064763; ENSMUSP00000068192; ENSMUSG00000052713. [Q56A10-1]
GeneIDi269023.
KEGGimmu:269023.
UCSCiuc008eyc.2. mouse. [Q56A10-1]
uc008eyg.1. mouse. [Q56A10-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiZN608_MOUSE
AccessioniPrimary (citable) accession number: Q56A10
Secondary accession number(s): Q6ZPU8, Q8BIG5, Q8BJ06
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: May 10, 2005
Last modified: October 25, 2017
This is version 90 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot