Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein Largen

Gene

PRR16

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulator of cell size that promotes cell size increase independently of mTOR and Hippo signaling pathways. Acts by stimulating the translation of specific mRNAs, including those encoding proteins affecting mitochondrial functions. Increases mitochondrial mass and respiration.1 Publication

Miscellaneous

Was named 'Largen' because overexpression causes cells enlargement.1 Publication

GO - Biological processi

  • positive regulation of cell size Source: UniProtKB
  • positive regulation of translation Source: UniProtKB

Names & Taxonomyi

Protein namesi
Recommended name:
Protein Largen
Alternative name(s):
Mesenchymal stem cell protein DSC54
Proline-rich protein 16
Gene namesi
Name:PRR16
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

EuPathDBiHostDB:ENSG00000184838.14
HGNCiHGNC:29654 PRR16
MIMi615931 gene
neXtProtiNX_Q569H4

Pathology & Biotechi

Organism-specific databases

DisGeNETi51334
OpenTargetsiENSG00000184838
PharmGKBiPA162400155

Polymorphism and mutation databases

BioMutaiPRR16
DMDMi74735958

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003081591 – 304Protein LargenAdd BLAST304

Proteomic databases

EPDiQ569H4
PaxDbiQ569H4
PeptideAtlasiQ569H4
PRIDEiQ569H4
ProteomicsDBi62570
62571 [Q569H4-2]
62572 [Q569H4-3]

PTM databases

PhosphoSitePlusiQ569H4

Expressioni

Gene expression databases

BgeeiENSG00000184838
CleanExiHS_PRR16
ExpressionAtlasiQ569H4 baseline and differential
GenevisibleiQ569H4 HS

Organism-specific databases

HPAiHPA049254

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi119481, 8 interactors
IntActiQ569H4, 2 interactors
STRINGi9606.ENSP00000368869

Structurei

3D structure databases

ProteinModelPortaliQ569H4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili33 – 70Sequence analysisAdd BLAST38

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi102 – 291Pro-richAdd BLAST190

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IGVQ Eukaryota
ENOG41129UN LUCA
GeneTreeiENSGT00910000144204
HOGENOMiHOG000015766
HOVERGENiHBG100197
InParanoidiQ569H4
OMAiPLMHRPE
OrthoDBiEOG091G0LZ5
PhylomeDBiQ569H4
TreeFamiTF332746

Family and domain databases

InterProiView protein in InterPro
IPR027997 DUF4589
PfamiView protein in Pfam
PF15252 DUF4589, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q569H4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAKSKGNPS SSCPAEGPPA ASKTKVKEQI KIIVEDLELV LGDLKDVAKE
60 70 80 90 100
LKEVVDQIDT LTSDLQLEDE MTDSSKTDTL NSSSSGTTAS SLEKIKVQAN
110 120 130 140 150
APLIKPPAHP SAILTVLRKP NPPPPPPRLT PVKCEDPKRV VPTANPVKTN
160 170 180 190 200
GTLLRNGGLP GGPNKIPNGD ICCIPNSNLD KAPVQLLMHR PEKDRCPQAG
210 220 230 240 250
PRERVRFNEK VQYHGYCPDC DTRYNIKNRE VHLHSEPVHP PGKIPHQGPP
260 270 280 290 300
LPPTPHLPPF PLENGGMGIS HSNSFPPIRP ATVPPPTAPK PQKTILRKST

TTTV
Length:304
Mass (Da):32,812
Last modified:May 10, 2005 - v1
Checksum:i42FF6EFF0AE2D2BF
GO
Isoform 2 (identifier: Q569H4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.

Show »
Length:234
Mass (Da):25,306
Checksum:i753AD3C385F6E865
GO
Isoform 3 (identifier: Q569H4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MSAKSKGNPS...LKDVAKELKE → MAQSGLTATSASQVQAILLPQPASVRHYAW

Note: No experimental confirmation available.
Show »
Length:281
Mass (Da):30,387
Checksum:i3BA8E7A63DCB8F24
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061694110P → T1 PublicationCorresponds to variant dbSNP:rs17853861Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0288801 – 70Missing in isoform 2. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_0288811 – 53MSAKS…KELKE → MAQSGLTATSASQVQAILLP QPASVRHYAW in isoform 3. 1 PublicationAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF242769 mRNA Translation: AAF65446.1
CH471086 Genomic DNA Translation: EAW48904.1
CH471086 Genomic DNA Translation: EAW48906.1
BC038838 mRNA Translation: AAH38838.1
BC092474 mRNA Translation: AAH92474.1
CCDSiCCDS4127.1 [Q569H4-3]
CCDS75290.1 [Q569H4-1]
CCDS78053.1 [Q569H4-2]
RefSeqiNP_001287712.1, NM_001300783.1 [Q569H4-1]
NP_001295016.1, NM_001308087.1 [Q569H4-2]
NP_001295017.1, NM_001308088.1 [Q569H4-2]
NP_057728.1, NM_016644.2 [Q569H4-3]
XP_011541756.1, XM_011543454.2 [Q569H4-2]
UniGeneiHs.157461
Hs.605607
Hs.681707

Genome annotation databases

EnsembliENST00000379551; ENSP00000368869; ENSG00000184838 [Q569H4-3]
ENST00000407149; ENSP00000385118; ENSG00000184838 [Q569H4-1]
ENST00000505123; ENSP00000423446; ENSG00000184838 [Q569H4-2]
GeneIDi51334
KEGGihsa:51334
UCSCiuc003ksp.4 human [Q569H4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiLARGN_HUMAN
AccessioniPrimary (citable) accession number: Q569H4
Secondary accession number(s): D3DSZ0, Q8IXY1, Q9NYI5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: May 10, 2005
Last modified: June 20, 2018
This is version 90 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health