Q569H4 (PRR16_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 56.
History...
Names·Attributes·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Proline-rich protein 16 Alternative name(s): Mesenchymal stem cell protein DSC54 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 304 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q569H4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q569H4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-70: Missing. | ||||||
| Isoform 3 (identifier: Q569H4-3) The sequence of this isoform differs from the canonical sequence as follows: 1-53: MSAKSKGNPS...LKDVAKELKE → MAQSGLTATSASQVQAILLPQPASVRHYAW | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 304 | 304 | Proline-rich protein 16 | PRO_0000308159 | |||||
Regions | |||||||||
| Coiled coil | 33 – 70 | 38 | Potential | ||||||
| Compositional bias | 102 – 291 | 190 | Pro-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 70 | 70 | Missing in isoform 2. | VSP_028880 | |||||
| Alternative sequence | 1 – 53 | 53 | MSAKS…KELKE → MAQSGLTATSASQVQAILLP QPASVRHYAW in isoform 3. | VSP_028881 | |||||
| Natural variant | 110 | 1 | P → T. Ref.3 Corresponds to variant rs17853861 [ dbSNP | Ensembl ]. | VAR_061694 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA DSC54 expressed by osteogenic human mesenchymal stem cells." van den Bos C., Mbalaviele G., Thiede M. Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-110. Tissue: Brain and Placenta. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF242769 mRNA. Translation: AAF65446.1. CH471086 Genomic DNA. Translation: EAW48904.1. CH471086 Genomic DNA. Translation: EAW48906.1. BC038838 mRNA. Translation: AAH38838.1. BC092474 mRNA. Translation: AAH92474.1. |
| IPI | IPI00555909. IPI00747522. IPI00868998. |
| RefSeq | NP_057728.1. NM_016644.1. |
| UniGene | Hs.157461. |
3D structure databases | |
| ProteinModelPortal | Q569H4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q569H4. 1 interaction. |
Polymorphism databases | |
| DMDM | 74735958. |
Proteomic databases | |
| PaxDb | Q569H4. |
| PRIDE | Q569H4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000379551; ENSP00000368869; ENSG00000184838. ENST00000407149; ENSP00000385118; ENSG00000184838. ENST00000446965; ENSP00000405491; ENSG00000184838. ENST00000505123; ENSP00000423446; ENSG00000184838. |
| GeneID | 51334. |
| KEGG | hsa:51334. |
| UCSC | uc003ksp.3. human. uc003ksq.3. human. |
Organism-specific databases | |
| CTD | 51334. |
| GeneCards | GC05P119828. |
| HGNC | HGNC:29654. PRR16. |
| HPA | HPA049254. |
| neXtProt | NX_Q569H4. |
| PharmGKB | PA162400155. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG44576. |
| HOGENOM | HOG000015766. |
| HOVERGEN | HBG100197. |
| InParanoid | Q569H4. |
| OMA | VQPLMHR. |
| OrthoDB | EOG4Z36FV. |
Gene expression databases | |
| ArrayExpress | Q569H4. |
| Bgee | Q569H4. |
| CleanEx | HS_PRR16. |
| Genevestigator | Q569H4. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 51334. |
| NextBio | 54755. |
Entry information
| Entry name | PRR16_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q569H4 Secondary accession number(s): D3DSZ0, Q8IXY1, Q9NYI5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with
