Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q569H4

- LARGN_HUMAN

UniProt

Q569H4 - LARGN_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein Largen

Gene

PRR16

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Regulator of cell size that promotes cell size increase independently of mTOR and Hippo signaling pathways. Acts by stimulating the translation of specific mRNAs, including those encoding proteins affecting mitochondrial functions. Increases mitochondrial mass and respiration.1 Publication

GO - Biological processi

  1. positive regulation of cell size Source: UniProtKB
  2. positive regulation of translation Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein Largen
Alternative name(s):
Mesenchymal stem cell protein DSC54
Proline-rich protein 16
Gene namesi
Name:PRR16
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:29654. PRR16.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162400155.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 304304Protein LargenPRO_0000308159Add
BLAST

Proteomic databases

PaxDbiQ569H4.
PRIDEiQ569H4.

Expressioni

Gene expression databases

BgeeiQ569H4.
CleanExiHS_PRR16.
ExpressionAtlasiQ569H4. baseline and differential.
GenevestigatoriQ569H4.

Organism-specific databases

HPAiHPA049254.

Interactioni

Protein-protein interaction databases

BioGridi119481. 5 interactions.
IntActiQ569H4. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ569H4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili33 – 7038Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi102 – 291190Pro-richAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG44576.
GeneTreeiENSGT00730000111273.
HOGENOMiHOG000015766.
HOVERGENiHBG100197.
InParanoidiQ569H4.
OMAiVQPLMHR.
OrthoDBiEOG76473X.
PhylomeDBiQ569H4.
TreeFamiTF332746.

Family and domain databases

InterProiIPR027997. DUF4589.
[Graphical view]
PfamiPF15252. DUF4589. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q569H4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAKSKGNPS SSCPAEGPPA ASKTKVKEQI KIIVEDLELV LGDLKDVAKE
60 70 80 90 100
LKEVVDQIDT LTSDLQLEDE MTDSSKTDTL NSSSSGTTAS SLEKIKVQAN
110 120 130 140 150
APLIKPPAHP SAILTVLRKP NPPPPPPRLT PVKCEDPKRV VPTANPVKTN
160 170 180 190 200
GTLLRNGGLP GGPNKIPNGD ICCIPNSNLD KAPVQLLMHR PEKDRCPQAG
210 220 230 240 250
PRERVRFNEK VQYHGYCPDC DTRYNIKNRE VHLHSEPVHP PGKIPHQGPP
260 270 280 290 300
LPPTPHLPPF PLENGGMGIS HSNSFPPIRP ATVPPPTAPK PQKTILRKST

TTTV
Length:304
Mass (Da):32,812
Last modified:May 10, 2005 - v1
Checksum:i42FF6EFF0AE2D2BF
GO
Isoform 2 (identifier: Q569H4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.

Show »
Length:234
Mass (Da):25,306
Checksum:i753AD3C385F6E865
GO
Isoform 3 (identifier: Q569H4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MSAKSKGNPS...LKDVAKELKE → MAQSGLTATSASQVQAILLPQPASVRHYAW

Note: No experimental confirmation available.

Show »
Length:281
Mass (Da):30,387
Checksum:i3BA8E7A63DCB8F24
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti110 – 1101P → T.1 Publication
Corresponds to variant rs17853861 [ dbSNP | Ensembl ].
VAR_061694

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7070Missing in isoform 2. 1 PublicationVSP_028880Add
BLAST
Alternative sequencei1 – 5353MSAKS…KELKE → MAQSGLTATSASQVQAILLP QPASVRHYAW in isoform 3. 1 PublicationVSP_028881Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF242769 mRNA. Translation: AAF65446.1.
CH471086 Genomic DNA. Translation: EAW48904.1.
CH471086 Genomic DNA. Translation: EAW48906.1.
BC038838 mRNA. Translation: AAH38838.1.
BC092474 mRNA. Translation: AAH92474.1.
CCDSiCCDS4127.1. [Q569H4-3]
CCDS75290.1. [Q569H4-1]
RefSeqiNP_001287712.1. NM_001300783.1. [Q569H4-1]
NP_057728.1. NM_016644.2. [Q569H4-3]
XP_005272069.1. XM_005272012.1. [Q569H4-2]
UniGeneiHs.157461.
Hs.605607.

Genome annotation databases

EnsembliENST00000379551; ENSP00000368869; ENSG00000184838. [Q569H4-3]
ENST00000407149; ENSP00000385118; ENSG00000184838. [Q569H4-1]
ENST00000505123; ENSP00000423446; ENSG00000184838. [Q569H4-2]
GeneIDi51334.
KEGGihsa:51334.
UCSCiuc003ksp.3. human. [Q569H4-3]
uc003ksq.3. human. [Q569H4-1]

Polymorphism databases

DMDMi74735958.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF242769 mRNA. Translation: AAF65446.1 .
CH471086 Genomic DNA. Translation: EAW48904.1 .
CH471086 Genomic DNA. Translation: EAW48906.1 .
BC038838 mRNA. Translation: AAH38838.1 .
BC092474 mRNA. Translation: AAH92474.1 .
CCDSi CCDS4127.1. [Q569H4-3 ]
CCDS75290.1. [Q569H4-1 ]
RefSeqi NP_001287712.1. NM_001300783.1. [Q569H4-1 ]
NP_057728.1. NM_016644.2. [Q569H4-3 ]
XP_005272069.1. XM_005272012.1. [Q569H4-2 ]
UniGenei Hs.157461.
Hs.605607.

3D structure databases

ProteinModelPortali Q569H4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119481. 5 interactions.
IntActi Q569H4. 1 interaction.

Polymorphism databases

DMDMi 74735958.

Proteomic databases

PaxDbi Q569H4.
PRIDEi Q569H4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000379551 ; ENSP00000368869 ; ENSG00000184838 . [Q569H4-3 ]
ENST00000407149 ; ENSP00000385118 ; ENSG00000184838 . [Q569H4-1 ]
ENST00000505123 ; ENSP00000423446 ; ENSG00000184838 . [Q569H4-2 ]
GeneIDi 51334.
KEGGi hsa:51334.
UCSCi uc003ksp.3. human. [Q569H4-3 ]
uc003ksq.3. human. [Q569H4-1 ]

Organism-specific databases

CTDi 51334.
GeneCardsi GC05P119828.
HGNCi HGNC:29654. PRR16.
HPAi HPA049254.
MIMi 615931. gene.
neXtProti NX_Q569H4.
PharmGKBi PA162400155.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG44576.
GeneTreei ENSGT00730000111273.
HOGENOMi HOG000015766.
HOVERGENi HBG100197.
InParanoidi Q569H4.
OMAi VQPLMHR.
OrthoDBi EOG76473X.
PhylomeDBi Q569H4.
TreeFami TF332746.

Miscellaneous databases

ChiTaRSi PRR16. human.
GenomeRNAii 51334.
NextBioi 54755.
PROi Q569H4.
SOURCEi Search...

Gene expression databases

Bgeei Q569H4.
CleanExi HS_PRR16.
ExpressionAtlasi Q569H4. baseline and differential.
Genevestigatori Q569H4.

Family and domain databases

InterProi IPR027997. DUF4589.
[Graphical view ]
Pfami PF15252. DUF4589. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "cDNA DSC54 expressed by osteogenic human mesenchymal stem cells."
    van den Bos C., Mbalaviele G., Thiede M.
    Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-110.
    Tissue: Brain and Placenta.
  4. Cited for: FUNCTION.

Entry informationi

Entry nameiLARGN_HUMAN
AccessioniPrimary (citable) accession number: Q569H4
Secondary accession number(s): D3DSZ0, Q8IXY1, Q9NYI5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: May 10, 2005
Last modified: November 26, 2014
This is version 68 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Was named 'Largen' because overexpression causes cells enlargement.1 Publication

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3