Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q569H4 (PRR16_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 63. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Proline-rich protein 16
Alternative name(s):
Mesenchymal stem cell protein DSC54
Gene names
Name:PRR16
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length304 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainCoiled coil
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q569H4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q569H4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
Isoform 3 (identifier: Q569H4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MSAKSKGNPS...LKDVAKELKE → MAQSGLTATSASQVQAILLPQPASVRHYAW
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 304304Proline-rich protein 16
PRO_0000308159

Regions

Coiled coil33 – 7038 Potential
Compositional bias102 – 291190Pro-rich

Natural variations

Alternative sequence1 – 7070Missing in isoform 2.
VSP_028880
Alternative sequence1 – 5353MSAKS…KELKE → MAQSGLTATSASQVQAILLP QPASVRHYAW in isoform 3.
VSP_028881
Natural variant1101P → T. Ref.3
Corresponds to variant rs17853861 [ dbSNP | Ensembl ].
VAR_061694

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 10, 2005. Version 1.
Checksum: 42FF6EFF0AE2D2BF

FASTA30432,812
        10         20         30         40         50         60 
MSAKSKGNPS SSCPAEGPPA ASKTKVKEQI KIIVEDLELV LGDLKDVAKE LKEVVDQIDT 

        70         80         90        100        110        120 
LTSDLQLEDE MTDSSKTDTL NSSSSGTTAS SLEKIKVQAN APLIKPPAHP SAILTVLRKP 

       130        140        150        160        170        180 
NPPPPPPRLT PVKCEDPKRV VPTANPVKTN GTLLRNGGLP GGPNKIPNGD ICCIPNSNLD 

       190        200        210        220        230        240 
KAPVQLLMHR PEKDRCPQAG PRERVRFNEK VQYHGYCPDC DTRYNIKNRE VHLHSEPVHP 

       250        260        270        280        290        300 
PGKIPHQGPP LPPTPHLPPF PLENGGMGIS HSNSFPPIRP ATVPPPTAPK PQKTILRKST 


TTTV 

« Hide

Isoform 2 [UniParc].

Checksum: 753AD3C385F6E865
Show »

FASTA23425,306
Isoform 3 [UniParc].

Checksum: 3BA8E7A63DCB8F24
Show »

FASTA28130,387

References

« Hide 'large scale' references
[1]"cDNA DSC54 expressed by osteogenic human mesenchymal stem cells."
van den Bos C., Mbalaviele G., Thiede M.
Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[2]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT THR-110.
Tissue: Brain and Placenta.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF242769 mRNA. Translation: AAF65446.1.
CH471086 Genomic DNA. Translation: EAW48904.1.
CH471086 Genomic DNA. Translation: EAW48906.1.
BC038838 mRNA. Translation: AAH38838.1.
BC092474 mRNA. Translation: AAH92474.1.
RefSeqNP_057728.1. NM_016644.1.
XP_005272067.1. XM_005272010.1.
XP_005272069.1. XM_005272012.1.
UniGeneHs.157461.

3D structure databases

ProteinModelPortalQ569H4.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119481. 5 interactions.
IntActQ569H4. 1 interaction.

Polymorphism databases

DMDM74735958.

Proteomic databases

PaxDbQ569H4.
PRIDEQ569H4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000379551; ENSP00000368869; ENSG00000184838. [Q569H4-3]
ENST00000407149; ENSP00000385118; ENSG00000184838. [Q569H4-1]
ENST00000446965; ENSP00000405491; ENSG00000184838. [Q569H4-2]
ENST00000505123; ENSP00000423446; ENSG00000184838. [Q569H4-2]
GeneID51334.
KEGGhsa:51334.
UCSCuc003ksp.3. human. [Q569H4-3]
uc003ksq.3. human. [Q569H4-1]

Organism-specific databases

CTD51334.
GeneCardsGC05P119828.
HGNCHGNC:29654. PRR16.
HPAHPA049254.
neXtProtNX_Q569H4.
PharmGKBPA162400155.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG44576.
HOGENOMHOG000015766.
HOVERGENHBG100197.
InParanoidQ569H4.
OMAVQPLMHR.
OrthoDBEOG76473X.
PhylomeDBQ569H4.
TreeFamTF332746.

Gene expression databases

ArrayExpressQ569H4.
BgeeQ569H4.
CleanExHS_PRR16.
GenevestigatorQ569H4.

Family and domain databases

InterProIPR027997. DUF4589.
[Graphical view]
PfamPF15252. DUF4589. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi51334.
NextBio54755.
PROQ569H4.

Entry information

Entry namePRR16_HUMAN
AccessionPrimary (citable) accession number: Q569H4
Secondary accession number(s): D3DSZ0, Q8IXY1, Q9NYI5
Entry history
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: May 10, 2005
Last modified: April 16, 2014
This is version 63 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM