Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Noelin-2

Gene

Olfm2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in transforming growth factor beta (TGF-beta)-induced smooth muscle differentiation. TGF-beta induces expression and nuclear translocation of OLFM2 where it binds to SRF, causing its dissociation from the transcriptional repressor HEY2/HERP1 and facilitating binding of SRF to target genes. Plays a role in AMPAR complex organization. Is a regulator of vascular smooth-muscle cell (SMC) phenotypic switching, that acts by promoting RUNX2 and inhibiting MYOCD binding to SRF. SMC phenotypic switching is the process through which vascular SMCs undergo transition between a quiescent contractile phenotype and a proliferative synthetic phenotype in response to pathological stimuli. SMC phenotypic plasticity is essential for vascular development and remodeling (PubMed:28062493).By similarity1 Publication

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin-2
Alternative name(s):
Olfactomedin-2
Gene namesi
Name:Olfm2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 8

Organism-specific databases

RGDi1309741 Olfm2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm, Membrane, Nucleus, Secreted, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 16Sequence analysisAdd BLAST16
ChainiPRO_000042068617 – 478Noelin-2Add BLAST462

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi33N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi98N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi179N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi219 ↔ 401PROSITE-ProRule annotation
Glycosylationi299N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi334N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi423N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi465N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ568Y7
PRIDEiQ568Y7

Expressioni

Tissue specificityi

Expressed in the brain (at protein level) (PubMed:22632720). Expressed in carotid arteries and the aorta, mainly in aortic SMCs (PubMed:28062493).2 Publications

Inductioni

Expression in SMCs and carotid arteries is up-regulated upon injury or by PDGFB.1 Publication

Gene expression databases

BgeeiENSRNOG00000020519

Interactioni

Subunit structurei

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM2. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing (PubMed:22632720). Interacts with GRIA2 (By similarity). Interacts with OLFM1 and OLFM3 (By similarity). Interacts with SRF; the interaction promotes dissociation of SRF from the transcriptional repressor HEY2 (By similarity). Interacts with RUNX2 (PubMed:28062493).By similarity2 Publications

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000027829

Structurei

3D structure databases

SMRiQ568Y7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini218 – 470Olfactomedin-likePROSITE-ProRule annotationAdd BLAST253

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili86 – 109Sequence analysisAdd BLAST24
Coiled coili160 – 218Sequence analysisAdd BLAST59

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiENOG410INP8 Eukaryota
ENOG410ZRHT LUCA
GeneTreeiENSGT00760000119005
HOGENOMiHOG000232069
HOVERGENiHBG006513
InParanoidiQ568Y7
OMAiMWPLTVP
OrthoDBiEOG091G05HN
PhylomeDBiQ568Y7
TreeFamiTF315964

Family and domain databases

InterProiView protein in InterPro
IPR031219 Noelin-2
IPR022082 Noelin_dom
IPR003112 Olfac-like_dom
PANTHERiPTHR23192:SF27 PTHR23192:SF27, 1 hit
PfamiView protein in Pfam
PF12308 Noelin-1, 1 hit
PF02191 OLF, 1 hit
SMARTiView protein in SMART
SM00284 OLF, 1 hit
PROSITEiView protein in PROSITE
PS51132 OLF, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q568Y7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVPLLKIGA VLSTMAMVTN WMSQTLPSLV GLNSTVSRAG SSEKITLFQS
60 70 80 90 100
PEEGWQLYTS AQAPDGKCIC TAVIPAQSTC ARDGRSRELR QLMEKVQNVS
110 120 130 140 150
QSMEVLELRT YRDLQYVRSM ETLMRSLDAR LRTADGSVSA KSFQELKDRM
160 170 180 190 200
TELLPLSSVL EQYKADTRTI VRLREEVRNL SGNLAAIQEE MGAYGYEDLQ
210 220 230 240 250
QRVMALEARL HACAQKLGCG KLTGVSNPIT IRAMGSRFGS WMTDTMAPSA
260 270 280 290 300
DSRVWYMDGY YKGRRVLEFR TLGDFIKGQN FIQHLLPQPW AGTGHVVYNG
310 320 330 340 350
SLFYNKYQSN VVVKYHFRSR SVLVQRSLPG AGYNNTFPYS WGGFSDMDFM
360 370 380 390 400
VDESGLWAVY TTNQNAGNIV VSRLDPHTLE VVRSWDTGYP KRSAGEAFMI
410 420 430 440 450
CGVLYVTNSH LAGAKVYFAY FTNTSSYEYT DVPFHNQYSH ISMLDYNPRE
460 470
RALYTWNNGH QVLYNVTLFH VISTAGDP
Length:478
Mass (Da):53,870
Last modified:May 10, 2005 - v1
Checksum:i688FD06A01B92E77
GO
Isoform 2 (identifier: Q568Y7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MSVPLLKIGAVLSTMAMVTNWMSQTLPSLVGLNSTVSRAGSSEKI → MRKLRQTGIAIAGDH

Show »
Length:448
Mass (Da):50,830
Checksum:iA8E3B8C400D826EC
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0445901 – 45MSVPL…SSEKI → MRKLRQTGIAIAGDH in isoform 2. CuratedAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH473993 Genomic DNA Translation: EDL78354.1
CH473993 Genomic DNA Translation: EDL78355.1
BC092647 mRNA Translation: AAH92647.1
RefSeqiNP_001015017.1, NM_001015017.1 [Q568Y7-1]
UniGeneiRn.105634

Genome annotation databases

EnsembliENSRNOT00000027829; ENSRNOP00000027829; ENSRNOG00000020519 [Q568Y7-1]
GeneIDi313783
KEGGirno:313783
UCSCiRGD:1309741 rat [Q568Y7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNOE2_RAT
AccessioniPrimary (citable) accession number: Q568Y7
Secondary accession number(s): A6JNL2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 9, 2013
Last sequence update: May 10, 2005
Last modified: March 28, 2018
This is version 80 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health