Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Noelin-2

Gene

Olfm2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Involved in transforming growth factor beta (TGF-beta)-induced smooth muscle differentiation. TGF-beta induces expression and nuclear translocation of OLFM2 where it binds to SRF, causing its dissociation from the transcriptional repressor HEY2/HERP1 and facilitating binding of SRF to target genes. Plays a role in AMPAR complex organization.By similarity

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin-2
Alternative name(s):
Olfactomedin-2
Gene namesi
Name:Olfm2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 8

Organism-specific databases

RGDi1309741. Olfm2.

Subcellular locationi

  • Secreted By similarity
  • Cell junctionsynapse 1 Publication
  • Membrane By similarity
  • Nucleus By similarity
  • Cytoplasm By similarity

  • Note: Nuclear localization is induced by TGF-beta.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Membrane, Nucleus, Secreted, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616Sequence analysisAdd
BLAST
Chaini17 – 478462Noelin-2PRO_0000420686Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi33 – 331N-linked (GlcNAc...)Sequence analysis
Glycosylationi98 – 981N-linked (GlcNAc...)Sequence analysis
Glycosylationi179 – 1791N-linked (GlcNAc...)Sequence analysis
Disulfide bondi219 ↔ 401PROSITE-ProRule annotation
Glycosylationi299 – 2991N-linked (GlcNAc...)Sequence analysis
Glycosylationi334 – 3341N-linked (GlcNAc...)Sequence analysis
Glycosylationi423 – 4231N-linked (GlcNAc...)Sequence analysis
Glycosylationi465 – 4651N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ568Y7.
PRIDEiQ568Y7.

Expressioni

Tissue specificityi

Expressed in the brain (at protein level).1 Publication

Interactioni

Subunit structurei

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM2. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing (PubMed:22632720). Interacts with GRIA2 (By similarity). Interacts with OLFM1 and OLFM3 (By similarity). Interacts with SRF; the interaction promotes dissociation of SRF from the transcriptional repressor HEY2 (By similarity).By similarity1 Publication

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000027829.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini218 – 470253Olfactomedin-likePROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili86 – 10924Sequence analysisAdd
BLAST
Coiled coili160 – 21859Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiENOG410INP8. Eukaryota.
ENOG410ZRHT. LUCA.
GeneTreeiENSGT00760000119005.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiQ568Y7.
OMAiFAYYTNT.
OrthoDBiEOG75F4CZ.
PhylomeDBiQ568Y7.
TreeFamiTF315964.

Family and domain databases

InterProiIPR031219. Noelin-2.
IPR022082. Noelin_dom.
IPR003112. Olfac-like_dom.
[Graphical view]
PANTHERiPTHR23192:SF27. PTHR23192:SF27. 1 hit.
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
PROSITEiPS51132. OLF. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q568Y7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVPLLKIGA VLSTMAMVTN WMSQTLPSLV GLNSTVSRAG SSEKITLFQS
60 70 80 90 100
PEEGWQLYTS AQAPDGKCIC TAVIPAQSTC ARDGRSRELR QLMEKVQNVS
110 120 130 140 150
QSMEVLELRT YRDLQYVRSM ETLMRSLDAR LRTADGSVSA KSFQELKDRM
160 170 180 190 200
TELLPLSSVL EQYKADTRTI VRLREEVRNL SGNLAAIQEE MGAYGYEDLQ
210 220 230 240 250
QRVMALEARL HACAQKLGCG KLTGVSNPIT IRAMGSRFGS WMTDTMAPSA
260 270 280 290 300
DSRVWYMDGY YKGRRVLEFR TLGDFIKGQN FIQHLLPQPW AGTGHVVYNG
310 320 330 340 350
SLFYNKYQSN VVVKYHFRSR SVLVQRSLPG AGYNNTFPYS WGGFSDMDFM
360 370 380 390 400
VDESGLWAVY TTNQNAGNIV VSRLDPHTLE VVRSWDTGYP KRSAGEAFMI
410 420 430 440 450
CGVLYVTNSH LAGAKVYFAY FTNTSSYEYT DVPFHNQYSH ISMLDYNPRE
460 470
RALYTWNNGH QVLYNVTLFH VISTAGDP
Length:478
Mass (Da):53,870
Last modified:May 10, 2005 - v1
Checksum:i688FD06A01B92E77
GO
Isoform 2 (identifier: Q568Y7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MSVPLLKIGAVLSTMAMVTNWMSQTLPSLVGLNSTVSRAGSSEKI → MRKLRQTGIAIAGDH

Show »
Length:448
Mass (Da):50,830
Checksum:iA8E3B8C400D826EC
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4545MSVPL…SSEKI → MRKLRQTGIAIAGDH in isoform 2. CuratedVSP_044590Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH473993 Genomic DNA. Translation: EDL78354.1.
CH473993 Genomic DNA. Translation: EDL78355.1.
BC092647 mRNA. Translation: AAH92647.1.
RefSeqiNP_001015017.1. NM_001015017.1. [Q568Y7-1]
UniGeneiRn.105634.

Genome annotation databases

EnsembliENSRNOT00000027829; ENSRNOP00000027829; ENSRNOG00000020519. [Q568Y7-1]
GeneIDi313783.
KEGGirno:313783.
UCSCiRGD:1309741. rat. [Q568Y7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH473993 Genomic DNA. Translation: EDL78354.1.
CH473993 Genomic DNA. Translation: EDL78355.1.
BC092647 mRNA. Translation: AAH92647.1.
RefSeqiNP_001015017.1. NM_001015017.1. [Q568Y7-1]
UniGeneiRn.105634.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000027829.

Proteomic databases

PaxDbiQ568Y7.
PRIDEiQ568Y7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000027829; ENSRNOP00000027829; ENSRNOG00000020519. [Q568Y7-1]
GeneIDi313783.
KEGGirno:313783.
UCSCiRGD:1309741. rat. [Q568Y7-1]

Organism-specific databases

CTDi93145.
RGDi1309741. Olfm2.

Phylogenomic databases

eggNOGiENOG410INP8. Eukaryota.
ENOG410ZRHT. LUCA.
GeneTreeiENSGT00760000119005.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiQ568Y7.
OMAiFAYYTNT.
OrthoDBiEOG75F4CZ.
PhylomeDBiQ568Y7.
TreeFamiTF315964.

Miscellaneous databases

PROiQ568Y7.

Family and domain databases

InterProiIPR031219. Noelin-2.
IPR022082. Noelin_dom.
IPR003112. Olfac-like_dom.
[Graphical view]
PANTHERiPTHR23192:SF27. PTHR23192:SF27. 1 hit.
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
PROSITEiPS51132. OLF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "High-resolution proteomics unravel architecture and molecular diversity of native AMPA receptor complexes."
    Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H., Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N., Schulte U., Fakler B.
    Neuron 74:621-633(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN AMPAR COMPLEX, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiNOE2_RAT
AccessioniPrimary (citable) accession number: Q568Y7
Secondary accession number(s): A6JNL2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 9, 2013
Last sequence update: May 10, 2005
Last modified: June 8, 2016
This is version 71 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.