Q55F94 (DLPA_DICDI) Reviewed, UniProtKB/Swiss-Prot
Last modified
September 21, 2011.
Version 35.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dynamin-like protein A EC=3.6.5.5 | ||||||
| Gene names |
| ||||||
| Organism | Dictyostelium discoideum (Slime mold) | ||||||
| Taxonomic identifier | 44689 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Amoebozoa › Mycetozoa › Dictyosteliida › Dictyostelium |
Protein attributes
| Sequence length | 880 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Involved in cytokinesis. May hydrolyze GTP. Ref.4 |
| Catalytic activity | GTP + H2O = GDP + phosphate. |
| Subcellular location | Cytoplasm Potential. Cleavage furrow. Note: During cytokinesis, found in the cleavage furrow. Ref.4 |
| Developmental stage | Expression begins during cell cycle progression, between 12 and 24 hours after germination. Reach a maximum around mid-log phase and disappear during the stationary phase. Expressed in the central funnel of cells of migrating slugs and at the top of rising culminants. Not expressed until the slug stage. Ref.2 Ref.4 |
| Induction | Induced by STATa. Ref.3 |
| Disruption phenotype | Produced cells are larger and a large amount of them contains more than 2 nuclei. Ref.4 |
| Sequence similarities | Belongs to the dynamin family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell cycle Cell division |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Ligand | GTP-binding Nucleotide-binding |
| Molecular function | Hydrolase Motor protein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell cycle Inferred from electronic annotation. Source: UniProtKB-KW cytokinesisInferred from mutant phenotype Ref.4. Source: dictyBase |
| Cellular component | cleavage furrow Inferred from direct assay Ref.4. Source: dictyBase cytoplasmInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW GTPase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q55F94-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q55F94-2) The sequence of this isoform differs from the canonical sequence as follows: 19-19: E → EVDNKKI | ||||||
| Isoform 3 (identifier: Q55F94-3) The sequence of this isoform differs from the canonical sequence as follows: 1-19: MSVFKKKDKSDDKKKKHDE → MISCTNHHRTIYQNNLNNSINNSNNTVDNKKI |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 880 | 880 | Dynamin-like protein A | PRO_0000371337 | |||||
Regions | |||||||||
| Nucleotide binding | 201 – 208 | 8 | GTP Potential | ||||||
| Nucleotide binding | 315 – 319 | 5 | GTP Potential | ||||||
| Nucleotide binding | 380 – 383 | 4 | GTP Potential | ||||||
| Coiled coil | 69 – 152 | 84 | Potential | ||||||
| Coiled coil | 479 – 509 | 31 | Potential | ||||||
| Coiled coil | 824 – 861 | 38 | Potential | ||||||
| Compositional bias | 13 – 16 | 4 | Poly-Lys | ||||||
| Compositional bias | 96 – 99 | 4 | Poly-Ala | ||||||
| Compositional bias | 132 – 138 | 7 | Poly-Ala | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 19 | 19 | MSVFK…KKHDE → MISCTNHHRTIYQNNLNNSI NNSNNTVDNKKI in isoform 3. | VSP_037019 | |||||
| Alternative sequence | 19 | 1 | E → EVDNKKI in isoform 2. | VSP_037020 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The genome of the social amoeba Dictyostelium discoideum." Eichinger L., Pachebat J.A., Gloeckner G., Rajandream M.A., Sucgang R., Berriman M., Song J., Olsen R., Szafranski K., Xu Q., Tunggal B., Kummerfeld S., Madera M., Konfortov B.A., Rivero F., Bankier A.T., Lehmann R., Hamlin N. Kuspa A.Nature 435:43-57(2005) [PubMed: 15875012] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING. Strain: AX4. |
| [2] | "Changing patterns of gene expression in Dictyostelium prestalk cell subtypes recognized by in situ hybridization with genes from microarray analyses." Maeda M., Sakamoto H., Iranfar N., Fuller D., Maruo T., Ogihara S., Morio T., Urushihara H., Tanaka Y., Loomis W.F. Eukaryot. Cell 2:627-637(2003) [PubMed: 12796308] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [3] | "Identification of new modes of Dd-STATa regulation of gene expression in Dictyostelium by in situ hybridisation." Shimada N., Maeda M., Urushihara H., Kawata T. Int. J. Dev. Biol. 48:679-682(2004) [PubMed: 15470642] [Abstract] Cited for: INDUCTION. |
| [4] | "Evolutionary linkage between eukaryotic cytokinesis and chloroplast division by dynamin proteins." Miyagishima S.Y., Kuwayama H., Urushihara H., Nakanishi H. Proc. Natl. Acad. Sci. U.S.A. 105:15202-15207(2008) [PubMed: 18809930] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE, DEVELOPMENTAL STAGE, SUBCELLULAR LOCATION. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AAFI02000003 Genomic DNA. Translation: EAL73749.1. AAFI02000003 Genomic DNA. Translation: EDR41124.1. AAFI02000003 Genomic DNA. Translation: EEU04162.1. |
| RefSeq | XP_001732949.1. XM_001732897.1. XP_002649212.1. XM_002649166.1. XP_647639.1. XM_642547.1. |
3D structure databases | |
| ProteinModelPortal | Q55F94. |
| ModBase | Search... |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblProtists | DDB0229901; DDB0229901; DDB_G0268592. |
| GeneID | 8616454. |
| GenomeReviews | Gene locus dlpA in contig CM000150_GR. |
| KEGG | ddi:DDB_G0268592. |
Organism-specific databases | |
| dictyBase | DDB_G0268592. dlpA. |
Phylogenomic databases | |
| eggNOG | KOG0446. |
| GeneTree | EPrGT00060000009519. |
| HOGENOM | HBG464489. |
| ProtClustDB | CLSZ2430155. |
Family and domain databases | |
| InterPro | IPR022812. Dynamin. IPR001401. Dynamin_GTPase. [Graphical view] |
| Pfam | PF00350. Dynamin_N. 1 hit. [Graphical view] |
| PRINTS | PR00195. DYNAMIN. |
| ProtoNet | Search... |
Entry information
| Entry name | DLPA_DICDI | ||||||||
| Accession | Primary (citable) accession number: Q55F94 Secondary accession number(s): B0G0Y6, C7FZW1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
Relevant documents
| Dictyostelium discoideum Dictyostelium discoideum: entries, gene names and cross-references to dictyBase |
| SIMILARITY comments Index of protein domains and families |

Clusters with