Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q53TN4 (CYBR1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 82. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cytochrome b reductase 1

EC=1.-.-.-
Alternative name(s):
Duodenal cytochrome b
Ferric-chelate reductase 3
Gene names
Name:CYBRD1
Synonyms:DCYTB, FRRS3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length286 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Ferric-chelate reductase that reduces Fe3+ to Fe2+. Present at the brush border of duodenal enterocytes where it probably reduces dietary Fe3+ thereby facilitating its transport into the mucosal cells. Uses ascorbate as electron donor. May be involved in extracellular ascorbate recycling in erythrocyte membranes. May also act as a ferrireductase in airway epithelial cells. Ref.11 Ref.16 Ref.17 Ref.19

Cofactor

Binds 2 heme groups non-covalently By similarity.

Subcellular location

Membrane; Multi-pass membrane protein Ref.8.

Tissue specificity

Present in erythrocyte membranes (at protein level). Also expressed in respiratory epithelium. Ref.19 Ref.20

Induction

By iron deficiency (at protein level). Ref.8 Ref.18

Polymorphism

Genetic variations in CYBRD1 may act as modifier of iron overload expression and account for the variance observed in serum ferritin levels in patients with hereditary hemochromatosis.

Sequence similarities

Contains 1 cytochrome b561 domain.

Sequence caution

The sequence CAG29366.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence CAG29367.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q53TN4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q53TN4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     66-286: IIVYRLPWTW...LDEAGQRSTM → SFRFFSLSAS...DSHQTAMETS
Note: No experimental confirmation available.
Isoform 3 (identifier: Q53TN4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVFIQGI → MLDEGE
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 286286Cytochrome b reductase 1
PRO_0000314830

Regions

Transmembrane12 – 3221Helical; Name=1; Potential
Transmembrane49 – 6921Helical; Name=2; Potential
Transmembrane85 – 10521Helical; Name=3; Potential
Transmembrane123 – 14321Helical; Name=4; Potential
Transmembrane158 – 17821Helical; Name=5; Potential
Transmembrane199 – 21921Helical; Name=6; Potential
Domain15 – 220206Cytochrome b561

Sites

Metal binding501Iron (heme axial ligand) Potential
Metal binding861Iron (heme axial ligand) Potential
Metal binding1081Iron (heme axial ligand) Potential
Metal binding1201Iron (heme axial ligand) Potential
Metal binding1591Iron (heme axial ligand) Potential

Amino acid modifications

Modified residue2851Phosphothreonine Ref.10 Ref.13 Ref.14
Glycosylation2311N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 6464MAMEG…FIQGI → MLDEGE in isoform 3.
VSP_044945
Alternative sequence66 – 286221IIVYR…QRSTM → SFRFFSLSASMGSAFSPSIS HAHTCLFWNCHLWNSDCNST YGIDRETDFFPERSCIQYIP ARRCFRKYAWPSDPGVRGPH FLDSHQTAMETS in isoform 2.
VSP_042039
Natural variant1561M → T. Ref.2
Corresponds to variant rs16859487 [ dbSNP | Ensembl ].
VAR_038065
Natural variant2261R → H in some patients with hereditary hemochromatosis. Ref.7 Ref.15
Corresponds to variant rs62181680 [ dbSNP | Ensembl ].
VAR_038066
Natural variant2661S → N. Ref.1 Ref.3 Ref.5 Ref.6
Corresponds to variant rs10455 [ dbSNP | Ensembl ].
VAR_038067

Experimental info

Sequence conflict71W → R in CAB66628. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 24, 2005. Version 1.
Checksum: 09AA921925A077F7

FASTA28631,641
        10         20         30         40         50         60 
MAMEGYWRFL ALLGSALLVG FLSVIFALVW VLHYREGLGW DGSALEFNWH PVLMVTGFVF 

        70         80         90        100        110        120 
IQGIAIIVYR LPWTWKCSKL LMKSIHAGLN AVAAILAIIS VVAVFENHNV NNIANMYSLH 

       130        140        150        160        170        180 
SWVGLIAVIC YLLQLLSGFS VFLLPWAPLS LRAFLMPIHV YSGIVIFGTV IATALMGLTE 

       190        200        210        220        230        240 
KLIFSLRDPA YSTFPPEGVF VNTLGLLILV FGALIFWIVT RPQWKRPKEP NSTILHPNGG 

       250        260        270        280 
TEQGARGSMP AYSGNNMDKS DSELNSEVAA RKRNLALDEA GQRSTM 

« Hide

Isoform 2 [UniParc].

Checksum: 581977048103DD99
Show »

FASTA15717,903
Isoform 3 [UniParc].

Checksum: C97981AD12C20361
Show »

FASTA22825,087

References

« Hide 'large scale' references
[1]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-266.
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT THR-156.
Tissue: Placenta, Small intestine, Synovium and Trachea.
[3]NIEHS SNPs program
Submitted (APR-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ASN-266.
[4]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ASN-266.
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-266.
Tissue: Skin.
[7]"Analysis of genes implicated in iron regulation in individuals presenting with primary iron overload."
Zaahl M.G., Merryweather-Clarke A.T., Kotze M.J., van der Merwe S., Warnich L., Robson K.J.H.
Hum. Genet. 115:409-417(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 65-134 AND 187-285, VARIANT HIS-226.
[8]"Duodenal cytochrome b and hephaestin expression in patients with iron deficiency and hemochromatosis."
Zoller H., Theurl I., Koch R.O., McKie A.T., Vogel W., Weiss G.
Gastroenterology 125:746-754(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, INDUCTION.
[9]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-285, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[11]"A novel association between a SNP in CYBRD1 and serum ferritin levels in a cohort study of HFE hereditary haemochromatosis."
Constantine C.C., Anderson G.J., Vulpe C.D., McLaren C.E., Bahlo M., Yeap H.L., Gertig D.M., Osborne N.J., Bertalli N.A., Beckman K.B., Chen V., Matak P., McKie A.T., Delatycki M.B., Olynyk J.K., English D.R., Southey M.C., Giles G.G. expand/collapse author list , Hopper J.L., Allen K.J., Gurrin L.C.
Br. J. Haematol. 147:140-149(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: POLYMORPHISM, ROLE IN HEREDITARY HEMOCHROMATOSIS.
[12]"Large-scale proteomics analysis of the human kinome."
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H.
Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[13]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-285, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[14]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-285, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[15]"Gene symbol: DCYTB/CYBRD1. Disease: primary iron overload."
Zaahl M.G., Merryweather-Clarke A.T., Kotze M.J., van der Merwe S., Warnich L., Robson K.J.
Hum. Genet. 118:546-546(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT HIS-226.
[16]"Gene symbol: DCYTB/CYBRD1. Disease: primary iron overload."
Zaahl M.G., Merryweather-Clarke A.T., Kotze M.J., van der Merwe S., Warnich L., Robson K.J.
Hum. Genet. 118:548-549(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: ROLE IN HEREDITARY HEMOCHROMATOSIS.
[17]"Gene symbol: DCYTB/CYBRD1. Disease: primary iron overload."
Zaahl M.G., Merryweather-Clarke A.T., Kotze M.J., van der Merwe S., Warnich L., Robson K.J.
Hum. Genet. 118:549-549(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: ROLE IN HEREDITARY HEMOCHROMATOSIS.
[18]"Immunolocalization of duodenal cytochrome B: a relationship with circulating markers of iron status."
Li A.C.Y., Warley A., Thoree V., Simpson R.J., McKie A.T., Kodjabashia K., Thompson R.P.H., Powell J.J.
Eur. J. Clin. Invest. 36:890-898(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: INDUCTION.
[19]"Human erythrocyte membranes contain a cytochrome b561 that may be involved in extracellular ascorbate recycling."
Su D., May J.M., Koury M.J., Asard H.
J. Biol. Chem. 281:39852-39859(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY.
[20]"Duodenal cytochrome b: a novel ferrireductase in airway epithelial cells."
Turi J.L., Wang X., McKie A.T., Nozik-Grayck E., Mamo L.B., Crissman K., Piantadosi C.A., Ghio A.J.
Am. J. Physiol. 291:L272-L280(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AL136693 mRNA. Translation: CAB66628.1.
AK027115 mRNA. Translation: BAB15661.1.
AK128495 mRNA. Translation: BAC87466.1.
AK291731 mRNA. Translation: BAF84420.1.
AK301485 mRNA. Translation: BAG62999.1.
AK316588 mRNA. Translation: BAG38176.1.
DQ496101 Genomic DNA. Translation: ABF47090.1.
AC007969 Genomic DNA. Translation: AAY14730.1.
CH471058 Genomic DNA. Translation: EAX11210.1.
BC065290 mRNA. Translation: AAH65290.1.
AJ715523 Genomic DNA. Translation: CAG29366.1. Sequence problems.
AJ715524 Genomic DNA. Translation: CAG29367.1. Sequence problems.
CCDSCCDS2244.1. [Q53TN4-1]
CCDS46449.1. [Q53TN4-2]
CCDS58736.1. [Q53TN4-3]
RefSeqNP_001120855.1. NM_001127383.1. [Q53TN4-2]
NP_001243838.1. NM_001256909.1. [Q53TN4-3]
NP_079119.3. NM_024843.3. [Q53TN4-1]
UniGeneHs.221941.

3D structure databases

ProteinModelPortalQ53TN4.
SMRQ53TN4. Positions 18-215.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122984. 1 interaction.
IntActQ53TN4. 1 interaction.
STRING9606.ENSP00000319141.

Protein family/group databases

TCDB5.B.2.1.3. the eukaryotic cytochrome b561 (cytb561) family.

PTM databases

PhosphoSiteQ53TN4.

Polymorphism databases

DMDM74726934.

Proteomic databases

MaxQBQ53TN4.
PaxDbQ53TN4.
PRIDEQ53TN4.

Protocols and materials databases

DNASU79901.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000321348; ENSP00000319141; ENSG00000071967. [Q53TN4-1]
ENST00000375252; ENSP00000364401; ENSG00000071967. [Q53TN4-2]
ENST00000409484; ENSP00000386739; ENSG00000071967. [Q53TN4-3]
GeneID79901.
KEGGhsa:79901.
UCSCuc002ugy.4. human. [Q53TN4-1]
uc002ugz.4. human. [Q53TN4-2]
uc031rqa.1. human.

Organism-specific databases

CTD79901.
GeneCardsGC02P172378.
H-InvDBHIX0002588.
HGNCHGNC:20797. CYBRD1.
HPAHPA014757.
MIM605745. gene.
neXtProtNX_Q53TN4.
PharmGKBPA134970061.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG259716.
HOGENOMHOG000143632.
HOVERGENHBG054164.
InParanoidQ53TN4.
KOK08370.
OMAMEGYRGF.
OrthoDBEOG7SJD5W.
PhylomeDBQ53TN4.
TreeFamTF314222.

Enzyme and pathway databases

BioCycMetaCyc:HS01046-MONOMER.
ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

ArrayExpressQ53TN4.
BgeeQ53TN4.
CleanExHS_CYBRD1.
GenevestigatorQ53TN4.

Family and domain databases

InterProIPR028838. Cybrd1.
IPR006593. Cyt_b561/ferric_Rdtase_TM.
IPR004877. Cyt_b561_euk.
[Graphical view]
PANTHERPTHR10106:SF1. PTHR10106:SF1. 1 hit.
PfamPF03188. Cytochrom_B561. 1 hit.
[Graphical view]
SMARTSM00665. B561. 1 hit.
[Graphical view]
PROSITEPS50939. CYTOCHROME_B561. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCYBRD1. human.
GenomeRNAi79901.
NextBio69747.
PROQ53TN4.
SOURCESearch...

Entry information

Entry nameCYBR1_HUMAN
AccessionPrimary (citable) accession number: Q53TN4
Secondary accession number(s): B2RE79 expand/collapse secondary AC list , B4DWD7, Q6KC16, Q6KC17, Q6P147, Q6ZR51, Q9H0Q8, Q9H5G5
Entry history
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 24, 2005
Last modified: July 9, 2014
This is version 82 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM