Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytochrome b reductase 1

Gene

CYBRD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Ferric-chelate reductase that reduces Fe3+ to Fe2+. Present at the brush border of duodenal enterocytes where it probably reduces dietary Fe3+ thereby facilitating its transport into the mucosal cells. Uses ascorbate as electron donor. May be involved in extracellular ascorbate recycling in erythrocyte membranes. May also act as a ferrireductase in airway epithelial cells.4 Publications

Cofactori

hemeBy similarityNote: Binds 2 heme groups non-covalently.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi50 – 501Iron (heme axial ligand)PROSITE-ProRule annotation
Metal bindingi86 – 861Iron (heme axial ligand)PROSITE-ProRule annotation
Metal bindingi108 – 1081Iron (heme axial ligand)PROSITE-ProRule annotation
Metal bindingi120 – 1201Iron (heme axial ligand)PROSITE-ProRule annotation
Metal bindingi159 – 1591Iron (heme axial ligand)PROSITE-ProRule annotation

GO - Molecular functioni

  1. ferric-chelate reductase activity Source: HGNC
  2. metal ion binding Source: UniProtKB-KW
  3. oxidoreductase activity, oxidizing metal ions Source: Reactome

GO - Biological processi

  1. cellular iron ion homeostasis Source: Reactome
  2. response to iron ion Source: Ensembl
  3. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Electron transport, Transport

Keywords - Ligandi

Heme, Iron, Metal-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS01046-MONOMER.
ReactomeiREACT_25060. Iron uptake and transport.

Protein family/group databases

TCDBi5.B.2.1.3. the eukaryotic cytochrome b561 (cytb561) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome b reductase 1 (EC:1.-.-.-)
Alternative name(s):
Duodenal cytochrome b
Ferric-chelate reductase 3
Gene namesi
Name:CYBRD1
Synonyms:DCYTB, FRRS3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:20797. CYBRD1.

Subcellular locationi

Membrane 1 Publication; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei12 – 3221Helical; Name=1Sequence AnalysisAdd
BLAST
Transmembranei49 – 6921Helical; Name=2Sequence AnalysisAdd
BLAST
Transmembranei85 – 10521Helical; Name=3Sequence AnalysisAdd
BLAST
Transmembranei123 – 14321Helical; Name=4Sequence AnalysisAdd
BLAST
Transmembranei158 – 17821Helical; Name=5Sequence AnalysisAdd
BLAST
Transmembranei199 – 21921Helical; Name=6Sequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. brush border membrane Source: Ensembl
  2. extracellular vesicular exosome Source: UniProtKB
  3. integral component of membrane Source: UniProtKB-KW
  4. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134970061.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 286286Cytochrome b reductase 1PRO_0000314830Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi231 – 2311N-linked (GlcNAc...)Sequence Analysis
Modified residuei285 – 2851Phosphothreonine3 Publications

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ53TN4.
PaxDbiQ53TN4.
PRIDEiQ53TN4.

PTM databases

PhosphoSiteiQ53TN4.

Expressioni

Tissue specificityi

Present in erythrocyte membranes (at protein level). Also expressed in respiratory epithelium.2 Publications

Inductioni

By iron deficiency (at protein level).2 Publications

Gene expression databases

BgeeiQ53TN4.
CleanExiHS_CYBRD1.
ExpressionAtlasiQ53TN4. baseline and differential.
GenevestigatoriQ53TN4.

Organism-specific databases

HPAiHPA014757.
HPA056736.

Interactioni

Protein-protein interaction databases

BioGridi122984. 2 interactions.
IntActiQ53TN4. 1 interaction.
STRINGi9606.ENSP00000319141.

Structurei

3D structure databases

ProteinModelPortaliQ53TN4.
SMRiQ53TN4. Positions 18-215.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini15 – 220206Cytochrome b561PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 cytochrome b561 domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG259716.
GeneTreeiENSGT00390000010986.
HOGENOMiHOG000143632.
HOVERGENiHBG054164.
InParanoidiQ53TN4.
KOiK08370.
OMAiMEGYRGF.
OrthoDBiEOG7SJD5W.
PhylomeDBiQ53TN4.
TreeFamiTF314222.

Family and domain databases

InterProiIPR028838. Cybrd1.
IPR006593. Cyt_b561/ferric_Rdtase_TM.
IPR004877. Cyt_b561_euk.
[Graphical view]
PANTHERiPTHR10106:SF1. PTHR10106:SF1. 1 hit.
PfamiPF03188. Cytochrom_B561. 1 hit.
[Graphical view]
SMARTiSM00665. B561. 1 hit.
[Graphical view]
PROSITEiPS50939. CYTOCHROME_B561. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q53TN4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAMEGYWRFL ALLGSALLVG FLSVIFALVW VLHYREGLGW DGSALEFNWH
60 70 80 90 100
PVLMVTGFVF IQGIAIIVYR LPWTWKCSKL LMKSIHAGLN AVAAILAIIS
110 120 130 140 150
VVAVFENHNV NNIANMYSLH SWVGLIAVIC YLLQLLSGFS VFLLPWAPLS
160 170 180 190 200
LRAFLMPIHV YSGIVIFGTV IATALMGLTE KLIFSLRDPA YSTFPPEGVF
210 220 230 240 250
VNTLGLLILV FGALIFWIVT RPQWKRPKEP NSTILHPNGG TEQGARGSMP
260 270 280
AYSGNNMDKS DSELNSEVAA RKRNLALDEA GQRSTM
Length:286
Mass (Da):31,641
Last modified:May 24, 2005 - v1
Checksum:i09AA921925A077F7
GO
Isoform 2 (identifier: Q53TN4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     66-286: IIVYRLPWTW...LDEAGQRSTM → SFRFFSLSAS...DSHQTAMETS

Note: No experimental confirmation available.

Show »
Length:157
Mass (Da):17,903
Checksum:i581977048103DD99
GO
Isoform 3 (identifier: Q53TN4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVFIQGI → MLDEGE

Note: No experimental confirmation available.

Show »
Length:228
Mass (Da):25,087
Checksum:iC97981AD12C20361
GO

Sequence cautioni

The sequence CAG29366.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAG29367.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti7 – 71W → R in CAB66628 (PubMed:11230166).Curated

Polymorphismi

Genetic variations in CYBRD1 may act as modifier of iron overload expression and account for the variance observed in serum ferritin levels in patients with hereditary hemochromatosis.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti156 – 1561M → T.1 Publication
Corresponds to variant rs16859487 [ dbSNP | Ensembl ].
VAR_038065
Natural varianti226 – 2261R → H in some patients with hereditary hemochromatosis. 2 Publications
Corresponds to variant rs62181680 [ dbSNP | Ensembl ].
VAR_038066
Natural varianti266 – 2661S → N.4 Publications
Corresponds to variant rs10455 [ dbSNP | Ensembl ].
VAR_038067

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6464MAMEG…FIQGI → MLDEGE in isoform 3. 1 PublicationVSP_044945Add
BLAST
Alternative sequencei66 – 286221IIVYR…QRSTM → SFRFFSLSASMGSAFSPSIS HAHTCLFWNCHLWNSDCNST YGIDRETDFFPERSCIQYIP ARRCFRKYAWPSDPGVRGPH FLDSHQTAMETS in isoform 2. 1 PublicationVSP_042039Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136693 mRNA. Translation: CAB66628.1.
AK027115 mRNA. Translation: BAB15661.1.
AK128495 mRNA. Translation: BAC87466.1.
AK291731 mRNA. Translation: BAF84420.1.
AK301485 mRNA. Translation: BAG62999.1.
AK316588 mRNA. Translation: BAG38176.1.
DQ496101 Genomic DNA. Translation: ABF47090.1.
AC007969 Genomic DNA. Translation: AAY14730.1.
CH471058 Genomic DNA. Translation: EAX11210.1.
BC065290 mRNA. Translation: AAH65290.1.
AJ715523 Genomic DNA. Translation: CAG29366.1. Sequence problems.
AJ715524 Genomic DNA. Translation: CAG29367.1. Sequence problems.
CCDSiCCDS2244.1. [Q53TN4-1]
CCDS46449.1. [Q53TN4-2]
CCDS58736.1. [Q53TN4-3]
RefSeqiNP_001120855.1. NM_001127383.1. [Q53TN4-2]
NP_001243838.1. NM_001256909.1. [Q53TN4-3]
NP_079119.3. NM_024843.3. [Q53TN4-1]
UniGeneiHs.221941.

Genome annotation databases

EnsembliENST00000321348; ENSP00000319141; ENSG00000071967. [Q53TN4-1]
ENST00000375252; ENSP00000364401; ENSG00000071967. [Q53TN4-2]
ENST00000409484; ENSP00000386739; ENSG00000071967. [Q53TN4-3]
GeneIDi79901.
KEGGihsa:79901.
UCSCiuc002ugy.4. human. [Q53TN4-1]
uc002ugz.4. human. [Q53TN4-2]
uc031rqa.1. human.

Polymorphism databases

DMDMi74726934.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL136693 mRNA. Translation: CAB66628.1.
AK027115 mRNA. Translation: BAB15661.1.
AK128495 mRNA. Translation: BAC87466.1.
AK291731 mRNA. Translation: BAF84420.1.
AK301485 mRNA. Translation: BAG62999.1.
AK316588 mRNA. Translation: BAG38176.1.
DQ496101 Genomic DNA. Translation: ABF47090.1.
AC007969 Genomic DNA. Translation: AAY14730.1.
CH471058 Genomic DNA. Translation: EAX11210.1.
BC065290 mRNA. Translation: AAH65290.1.
AJ715523 Genomic DNA. Translation: CAG29366.1. Sequence problems.
AJ715524 Genomic DNA. Translation: CAG29367.1. Sequence problems.
CCDSiCCDS2244.1. [Q53TN4-1]
CCDS46449.1. [Q53TN4-2]
CCDS58736.1. [Q53TN4-3]
RefSeqiNP_001120855.1. NM_001127383.1. [Q53TN4-2]
NP_001243838.1. NM_001256909.1. [Q53TN4-3]
NP_079119.3. NM_024843.3. [Q53TN4-1]
UniGeneiHs.221941.

3D structure databases

ProteinModelPortaliQ53TN4.
SMRiQ53TN4. Positions 18-215.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122984. 2 interactions.
IntActiQ53TN4. 1 interaction.
STRINGi9606.ENSP00000319141.

Protein family/group databases

TCDBi5.B.2.1.3. the eukaryotic cytochrome b561 (cytb561) family.

PTM databases

PhosphoSiteiQ53TN4.

Polymorphism databases

DMDMi74726934.

Proteomic databases

MaxQBiQ53TN4.
PaxDbiQ53TN4.
PRIDEiQ53TN4.

Protocols and materials databases

DNASUi79901.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000321348; ENSP00000319141; ENSG00000071967. [Q53TN4-1]
ENST00000375252; ENSP00000364401; ENSG00000071967. [Q53TN4-2]
ENST00000409484; ENSP00000386739; ENSG00000071967. [Q53TN4-3]
GeneIDi79901.
KEGGihsa:79901.
UCSCiuc002ugy.4. human. [Q53TN4-1]
uc002ugz.4. human. [Q53TN4-2]
uc031rqa.1. human.

Organism-specific databases

CTDi79901.
GeneCardsiGC02P172378.
H-InvDBHIX0002588.
HGNCiHGNC:20797. CYBRD1.
HPAiHPA014757.
HPA056736.
MIMi605745. gene.
neXtProtiNX_Q53TN4.
PharmGKBiPA134970061.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG259716.
GeneTreeiENSGT00390000010986.
HOGENOMiHOG000143632.
HOVERGENiHBG054164.
InParanoidiQ53TN4.
KOiK08370.
OMAiMEGYRGF.
OrthoDBiEOG7SJD5W.
PhylomeDBiQ53TN4.
TreeFamiTF314222.

Enzyme and pathway databases

BioCyciMetaCyc:HS01046-MONOMER.
ReactomeiREACT_25060. Iron uptake and transport.

Miscellaneous databases

ChiTaRSiCYBRD1. human.
GenomeRNAii79901.
NextBioi69747.
PROiQ53TN4.
SOURCEiSearch...

Gene expression databases

BgeeiQ53TN4.
CleanExiHS_CYBRD1.
ExpressionAtlasiQ53TN4. baseline and differential.
GenevestigatoriQ53TN4.

Family and domain databases

InterProiIPR028838. Cybrd1.
IPR006593. Cyt_b561/ferric_Rdtase_TM.
IPR004877. Cyt_b561_euk.
[Graphical view]
PANTHERiPTHR10106:SF1. PTHR10106:SF1. 1 hit.
PfamiPF03188. Cytochrom_B561. 1 hit.
[Graphical view]
SMARTiSM00665. B561. 1 hit.
[Graphical view]
PROSITEiPS50939. CYTOCHROME_B561. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-266.
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT THR-156.
    Tissue: Placenta, Small intestine, Synovium and Trachea.
  3. NIEHS SNPs program
    Submitted (APR-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ASN-266.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ASN-266.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-266.
    Tissue: Skin.
  7. "Analysis of genes implicated in iron regulation in individuals presenting with primary iron overload."
    Zaahl M.G., Merryweather-Clarke A.T., Kotze M.J., van der Merwe S., Warnich L., Robson K.J.H.
    Hum. Genet. 115:409-417(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 65-134 AND 187-285, VARIANT HIS-226.
  8. "Duodenal cytochrome b and hephaestin expression in patients with iron deficiency and hemochromatosis."
    Zoller H., Theurl I., Koch R.O., McKie A.T., Vogel W., Weiss G.
    Gastroenterology 125:746-754(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, INDUCTION.
  9. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-285, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. Cited for: POLYMORPHISM, ROLE IN HEREDITARY HEMOCHROMATOSIS.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-285, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-285, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. "Gene symbol: DCYTB/CYBRD1. Disease: primary iron overload."
    Zaahl M.G., Merryweather-Clarke A.T., Kotze M.J., van der Merwe S., Warnich L., Robson K.J.
    Hum. Genet. 118:546-546(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT HIS-226.
  16. "Gene symbol: DCYTB/CYBRD1. Disease: primary iron overload."
    Zaahl M.G., Merryweather-Clarke A.T., Kotze M.J., van der Merwe S., Warnich L., Robson K.J.
    Hum. Genet. 118:548-549(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: ROLE IN HEREDITARY HEMOCHROMATOSIS.
  17. "Gene symbol: DCYTB/CYBRD1. Disease: primary iron overload."
    Zaahl M.G., Merryweather-Clarke A.T., Kotze M.J., van der Merwe S., Warnich L., Robson K.J.
    Hum. Genet. 118:549-549(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: ROLE IN HEREDITARY HEMOCHROMATOSIS.
  18. "Immunolocalization of duodenal cytochrome B: a relationship with circulating markers of iron status."
    Li A.C.Y., Warley A., Thoree V., Simpson R.J., McKie A.T., Kodjabashia K., Thompson R.P.H., Powell J.J.
    Eur. J. Clin. Invest. 36:890-898(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  19. "Human erythrocyte membranes contain a cytochrome b561 that may be involved in extracellular ascorbate recycling."
    Su D., May J.M., Koury M.J., Asard H.
    J. Biol. Chem. 281:39852-39859(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  20. "Duodenal cytochrome b: a novel ferrireductase in airway epithelial cells."
    Turi J.L., Wang X., McKie A.T., Nozik-Grayck E., Mamo L.B., Crissman K., Piantadosi C.A., Ghio A.J.
    Am. J. Physiol. 291:L272-L280(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiCYBR1_HUMAN
AccessioniPrimary (citable) accession number: Q53TN4
Secondary accession number(s): B2RE79
, B4DWD7, Q6KC16, Q6KC17, Q6P147, Q6ZR51, Q9H0Q8, Q9H5G5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 24, 2005
Last modified: March 4, 2015
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.