Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q53TN4

- CYBR1_HUMAN

UniProt

Q53TN4 - CYBR1_HUMAN

Protein

Cytochrome b reductase 1

Gene

CYBRD1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 84 (01 Oct 2014)
      Sequence version 1 (24 May 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Ferric-chelate reductase that reduces Fe3+ to Fe2+. Present at the brush border of duodenal enterocytes where it probably reduces dietary Fe3+ thereby facilitating its transport into the mucosal cells. Uses ascorbate as electron donor. May be involved in extracellular ascorbate recycling in erythrocyte membranes. May also act as a ferrireductase in airway epithelial cells.4 Publications

    Cofactori

    Binds 2 heme groups non-covalently.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi50 – 501Iron (heme axial ligand)PROSITE-ProRule annotation
    Metal bindingi86 – 861Iron (heme axial ligand)PROSITE-ProRule annotation
    Metal bindingi108 – 1081Iron (heme axial ligand)PROSITE-ProRule annotation
    Metal bindingi120 – 1201Iron (heme axial ligand)PROSITE-ProRule annotation
    Metal bindingi159 – 1591Iron (heme axial ligand)PROSITE-ProRule annotation

    GO - Molecular functioni

    1. ferric-chelate reductase activity Source: HGNC
    2. metal ion binding Source: UniProtKB-KW
    3. oxidoreductase activity, oxidizing metal ions Source: Reactome

    GO - Biological processi

    1. cellular iron ion homeostasis Source: Reactome
    2. response to iron ion Source: Ensembl
    3. transmembrane transport Source: Reactome

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Biological processi

    Electron transport, Transport

    Keywords - Ligandi

    Heme, Iron, Metal-binding

    Enzyme and pathway databases

    BioCyciMetaCyc:HS01046-MONOMER.
    ReactomeiREACT_25060. Iron uptake and transport.

    Protein family/group databases

    TCDBi5.B.2.1.3. the eukaryotic cytochrome b561 (cytb561) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytochrome b reductase 1 (EC:1.-.-.-)
    Alternative name(s):
    Duodenal cytochrome b
    Ferric-chelate reductase 3
    Gene namesi
    Name:CYBRD1
    Synonyms:DCYTB, FRRS3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:20797. CYBRD1.

    Subcellular locationi

    Membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. brush border membrane Source: Ensembl
    2. extracellular vesicular exosome Source: UniProt
    3. integral component of membrane Source: UniProtKB-KW
    4. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134970061.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 286286Cytochrome b reductase 1PRO_0000314830Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi231 – 2311N-linked (GlcNAc...)Sequence Analysis
    Modified residuei285 – 2851Phosphothreonine3 Publications

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ53TN4.
    PaxDbiQ53TN4.
    PRIDEiQ53TN4.

    PTM databases

    PhosphoSiteiQ53TN4.

    Expressioni

    Tissue specificityi

    Present in erythrocyte membranes (at protein level). Also expressed in respiratory epithelium.2 Publications

    Inductioni

    By iron deficiency (at protein level).2 Publications

    Gene expression databases

    ArrayExpressiQ53TN4.
    BgeeiQ53TN4.
    CleanExiHS_CYBRD1.
    GenevestigatoriQ53TN4.

    Organism-specific databases

    HPAiHPA014757.

    Interactioni

    Protein-protein interaction databases

    BioGridi122984. 1 interaction.
    IntActiQ53TN4. 1 interaction.
    STRINGi9606.ENSP00000319141.

    Structurei

    3D structure databases

    ProteinModelPortaliQ53TN4.
    SMRiQ53TN4. Positions 18-215.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei12 – 3221Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei49 – 6921Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei85 – 10521Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei123 – 14321Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei158 – 17821Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei199 – 21921Helical; Name=6Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini15 – 220206Cytochrome b561PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 cytochrome b561 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG259716.
    HOGENOMiHOG000143632.
    HOVERGENiHBG054164.
    InParanoidiQ53TN4.
    KOiK08370.
    OMAiMEGYRGF.
    OrthoDBiEOG7SJD5W.
    PhylomeDBiQ53TN4.
    TreeFamiTF314222.

    Family and domain databases

    InterProiIPR028838. Cybrd1.
    IPR006593. Cyt_b561/ferric_Rdtase_TM.
    IPR004877. Cyt_b561_euk.
    [Graphical view]
    PANTHERiPTHR10106:SF1. PTHR10106:SF1. 1 hit.
    PfamiPF03188. Cytochrom_B561. 1 hit.
    [Graphical view]
    SMARTiSM00665. B561. 1 hit.
    [Graphical view]
    PROSITEiPS50939. CYTOCHROME_B561. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q53TN4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAMEGYWRFL ALLGSALLVG FLSVIFALVW VLHYREGLGW DGSALEFNWH    50
    PVLMVTGFVF IQGIAIIVYR LPWTWKCSKL LMKSIHAGLN AVAAILAIIS 100
    VVAVFENHNV NNIANMYSLH SWVGLIAVIC YLLQLLSGFS VFLLPWAPLS 150
    LRAFLMPIHV YSGIVIFGTV IATALMGLTE KLIFSLRDPA YSTFPPEGVF 200
    VNTLGLLILV FGALIFWIVT RPQWKRPKEP NSTILHPNGG TEQGARGSMP 250
    AYSGNNMDKS DSELNSEVAA RKRNLALDEA GQRSTM 286
    Length:286
    Mass (Da):31,641
    Last modified:May 24, 2005 - v1
    Checksum:i09AA921925A077F7
    GO
    Isoform 2 (identifier: Q53TN4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         66-286: IIVYRLPWTW...LDEAGQRSTM → SFRFFSLSAS...DSHQTAMETS

    Note: No experimental confirmation available.

    Show »
    Length:157
    Mass (Da):17,903
    Checksum:i581977048103DD99
    GO
    Isoform 3 (identifier: Q53TN4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-64: MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVFIQGI → MLDEGE

    Note: No experimental confirmation available.

    Show »
    Length:228
    Mass (Da):25,087
    Checksum:iC97981AD12C20361
    GO

    Sequence cautioni

    The sequence CAG29366.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAG29367.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti7 – 71W → R in CAB66628. (PubMed:11230166)Curated

    Polymorphismi

    Genetic variations in CYBRD1 may act as modifier of iron overload expression and account for the variance observed in serum ferritin levels in patients with hereditary hemochromatosis.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti156 – 1561M → T.1 Publication
    Corresponds to variant rs16859487 [ dbSNP | Ensembl ].
    VAR_038065
    Natural varianti226 – 2261R → H in some patients with hereditary hemochromatosis. 2 Publications
    Corresponds to variant rs62181680 [ dbSNP | Ensembl ].
    VAR_038066
    Natural varianti266 – 2661S → N.4 Publications
    Corresponds to variant rs10455 [ dbSNP | Ensembl ].
    VAR_038067

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6464MAMEG…FIQGI → MLDEGE in isoform 3. 1 PublicationVSP_044945Add
    BLAST
    Alternative sequencei66 – 286221IIVYR…QRSTM → SFRFFSLSASMGSAFSPSIS HAHTCLFWNCHLWNSDCNST YGIDRETDFFPERSCIQYIP ARRCFRKYAWPSDPGVRGPH FLDSHQTAMETS in isoform 2. 1 PublicationVSP_042039Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL136693 mRNA. Translation: CAB66628.1.
    AK027115 mRNA. Translation: BAB15661.1.
    AK128495 mRNA. Translation: BAC87466.1.
    AK291731 mRNA. Translation: BAF84420.1.
    AK301485 mRNA. Translation: BAG62999.1.
    AK316588 mRNA. Translation: BAG38176.1.
    DQ496101 Genomic DNA. Translation: ABF47090.1.
    AC007969 Genomic DNA. Translation: AAY14730.1.
    CH471058 Genomic DNA. Translation: EAX11210.1.
    BC065290 mRNA. Translation: AAH65290.1.
    AJ715523 Genomic DNA. Translation: CAG29366.1. Sequence problems.
    AJ715524 Genomic DNA. Translation: CAG29367.1. Sequence problems.
    CCDSiCCDS2244.1. [Q53TN4-1]
    CCDS46449.1. [Q53TN4-2]
    CCDS58736.1. [Q53TN4-3]
    RefSeqiNP_001120855.1. NM_001127383.1. [Q53TN4-2]
    NP_001243838.1. NM_001256909.1. [Q53TN4-3]
    NP_079119.3. NM_024843.3. [Q53TN4-1]
    UniGeneiHs.221941.

    Genome annotation databases

    EnsembliENST00000321348; ENSP00000319141; ENSG00000071967. [Q53TN4-1]
    ENST00000375252; ENSP00000364401; ENSG00000071967. [Q53TN4-2]
    ENST00000409484; ENSP00000386739; ENSG00000071967. [Q53TN4-3]
    GeneIDi79901.
    KEGGihsa:79901.
    UCSCiuc002ugy.4. human. [Q53TN4-1]
    uc002ugz.4. human. [Q53TN4-2]
    uc031rqa.1. human.

    Polymorphism databases

    DMDMi74726934.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AL136693 mRNA. Translation: CAB66628.1 .
    AK027115 mRNA. Translation: BAB15661.1 .
    AK128495 mRNA. Translation: BAC87466.1 .
    AK291731 mRNA. Translation: BAF84420.1 .
    AK301485 mRNA. Translation: BAG62999.1 .
    AK316588 mRNA. Translation: BAG38176.1 .
    DQ496101 Genomic DNA. Translation: ABF47090.1 .
    AC007969 Genomic DNA. Translation: AAY14730.1 .
    CH471058 Genomic DNA. Translation: EAX11210.1 .
    BC065290 mRNA. Translation: AAH65290.1 .
    AJ715523 Genomic DNA. Translation: CAG29366.1 . Sequence problems.
    AJ715524 Genomic DNA. Translation: CAG29367.1 . Sequence problems.
    CCDSi CCDS2244.1. [Q53TN4-1 ]
    CCDS46449.1. [Q53TN4-2 ]
    CCDS58736.1. [Q53TN4-3 ]
    RefSeqi NP_001120855.1. NM_001127383.1. [Q53TN4-2 ]
    NP_001243838.1. NM_001256909.1. [Q53TN4-3 ]
    NP_079119.3. NM_024843.3. [Q53TN4-1 ]
    UniGenei Hs.221941.

    3D structure databases

    ProteinModelPortali Q53TN4.
    SMRi Q53TN4. Positions 18-215.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122984. 1 interaction.
    IntActi Q53TN4. 1 interaction.
    STRINGi 9606.ENSP00000319141.

    Protein family/group databases

    TCDBi 5.B.2.1.3. the eukaryotic cytochrome b561 (cytb561) family.

    PTM databases

    PhosphoSitei Q53TN4.

    Polymorphism databases

    DMDMi 74726934.

    Proteomic databases

    MaxQBi Q53TN4.
    PaxDbi Q53TN4.
    PRIDEi Q53TN4.

    Protocols and materials databases

    DNASUi 79901.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000321348 ; ENSP00000319141 ; ENSG00000071967 . [Q53TN4-1 ]
    ENST00000375252 ; ENSP00000364401 ; ENSG00000071967 . [Q53TN4-2 ]
    ENST00000409484 ; ENSP00000386739 ; ENSG00000071967 . [Q53TN4-3 ]
    GeneIDi 79901.
    KEGGi hsa:79901.
    UCSCi uc002ugy.4. human. [Q53TN4-1 ]
    uc002ugz.4. human. [Q53TN4-2 ]
    uc031rqa.1. human.

    Organism-specific databases

    CTDi 79901.
    GeneCardsi GC02P172378.
    H-InvDB HIX0002588.
    HGNCi HGNC:20797. CYBRD1.
    HPAi HPA014757.
    MIMi 605745. gene.
    neXtProti NX_Q53TN4.
    PharmGKBi PA134970061.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG259716.
    HOGENOMi HOG000143632.
    HOVERGENi HBG054164.
    InParanoidi Q53TN4.
    KOi K08370.
    OMAi MEGYRGF.
    OrthoDBi EOG7SJD5W.
    PhylomeDBi Q53TN4.
    TreeFami TF314222.

    Enzyme and pathway databases

    BioCyci MetaCyc:HS01046-MONOMER.
    Reactomei REACT_25060. Iron uptake and transport.

    Miscellaneous databases

    ChiTaRSi CYBRD1. human.
    GenomeRNAii 79901.
    NextBioi 69747.
    PROi Q53TN4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q53TN4.
    Bgeei Q53TN4.
    CleanExi HS_CYBRD1.
    Genevestigatori Q53TN4.

    Family and domain databases

    InterProi IPR028838. Cybrd1.
    IPR006593. Cyt_b561/ferric_Rdtase_TM.
    IPR004877. Cyt_b561_euk.
    [Graphical view ]
    PANTHERi PTHR10106:SF1. PTHR10106:SF1. 1 hit.
    Pfami PF03188. Cytochrom_B561. 1 hit.
    [Graphical view ]
    SMARTi SM00665. B561. 1 hit.
    [Graphical view ]
    PROSITEi PS50939. CYTOCHROME_B561. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-266.
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), VARIANT THR-156.
      Tissue: Placenta, Small intestine, Synovium and Trachea.
    3. NIEHS SNPs program
      Submitted (APR-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ASN-266.
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ASN-266.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-266.
      Tissue: Skin.
    7. "Analysis of genes implicated in iron regulation in individuals presenting with primary iron overload."
      Zaahl M.G., Merryweather-Clarke A.T., Kotze M.J., van der Merwe S., Warnich L., Robson K.J.H.
      Hum. Genet. 115:409-417(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 65-134 AND 187-285, VARIANT HIS-226.
    8. "Duodenal cytochrome b and hephaestin expression in patients with iron deficiency and hemochromatosis."
      Zoller H., Theurl I., Koch R.O., McKie A.T., Vogel W., Weiss G.
      Gastroenterology 125:746-754(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, INDUCTION.
    9. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-285, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. Cited for: POLYMORPHISM, ROLE IN HEREDITARY HEMOCHROMATOSIS.
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-285, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-285, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. "Gene symbol: DCYTB/CYBRD1. Disease: primary iron overload."
      Zaahl M.G., Merryweather-Clarke A.T., Kotze M.J., van der Merwe S., Warnich L., Robson K.J.
      Hum. Genet. 118:546-546(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANT HIS-226.
    16. "Gene symbol: DCYTB/CYBRD1. Disease: primary iron overload."
      Zaahl M.G., Merryweather-Clarke A.T., Kotze M.J., van der Merwe S., Warnich L., Robson K.J.
      Hum. Genet. 118:548-549(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: ROLE IN HEREDITARY HEMOCHROMATOSIS.
    17. "Gene symbol: DCYTB/CYBRD1. Disease: primary iron overload."
      Zaahl M.G., Merryweather-Clarke A.T., Kotze M.J., van der Merwe S., Warnich L., Robson K.J.
      Hum. Genet. 118:549-549(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: ROLE IN HEREDITARY HEMOCHROMATOSIS.
    18. "Immunolocalization of duodenal cytochrome B: a relationship with circulating markers of iron status."
      Li A.C.Y., Warley A., Thoree V., Simpson R.J., McKie A.T., Kodjabashia K., Thompson R.P.H., Powell J.J.
      Eur. J. Clin. Invest. 36:890-898(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.
    19. "Human erythrocyte membranes contain a cytochrome b561 that may be involved in extracellular ascorbate recycling."
      Su D., May J.M., Koury M.J., Asard H.
      J. Biol. Chem. 281:39852-39859(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    20. "Duodenal cytochrome b: a novel ferrireductase in airway epithelial cells."
      Turi J.L., Wang X., McKie A.T., Nozik-Grayck E., Mamo L.B., Crissman K., Piantadosi C.A., Ghio A.J.
      Am. J. Physiol. 291:L272-L280(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiCYBR1_HUMAN
    AccessioniPrimary (citable) accession number: Q53TN4
    Secondary accession number(s): B2RE79
    , B4DWD7, Q6KC16, Q6KC17, Q6P147, Q6ZR51, Q9H0Q8, Q9H5G5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 15, 2008
    Last sequence update: May 24, 2005
    Last modified: October 1, 2014
    This is version 84 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3