Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cordon-bleu protein-like 1

Gene

COBLL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • actin monomer binding Source: GO_Central
  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Cordon-bleu protein-like 1
Gene namesi
Name:COBLL1
Synonyms:KIAA0977
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:23571. COBLL1.

Subcellular locationi

GO - Cellular componenti

  • cell-cell adherens junction Source: BHF-UCL
  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi22837.
OpenTargetsiENSG00000082438.
PharmGKBiPA134990267.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002604931 – 1204Cordon-bleu protein-like 1Add BLAST1204

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei177PhosphothreonineBy similarity1
Modified residuei242PhosphoserineCombined sources1
Modified residuei260PhosphoserineCombined sources1
Modified residuei294PhosphoserineCombined sources1
Modified residuei298PhosphothreonineCombined sources1
Modified residuei311PhosphoserineCombined sources1
Modified residuei322PhosphothreonineCombined sources1
Modified residuei364PhosphoserineBy similarity1
Modified residuei371PhosphoserineBy similarity1
Modified residuei382PhosphoserineCombined sources1
Modified residuei394PhosphoserineCombined sources1
Modified residuei515PhosphoserineCombined sources1
Modified residuei518PhosphoserineCombined sources1
Modified residuei538PhosphoserineBy similarity1
Modified residuei548PhosphoserineBy similarity1
Modified residuei551PhosphoserineBy similarity1
Modified residuei639PhosphoserineBy similarity1
Modified residuei660PhosphoserineBy similarity1
Modified residuei862PhosphoserineCombined sources1
Modified residuei889PhosphoserineBy similarity1
Modified residuei890PhosphoserineCombined sources1
Modified residuei897PhosphoserineCombined sources1
Modified residuei987PhosphoserineCombined sources1
Modified residuei993PhosphoserineCombined sources1
Modified residuei1023PhosphoserineBy similarity1
Modified residuei1145PhosphoserineBy similarity1
Modified residuei1146PhosphoserineBy similarity1
Modified residuei1197PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ53SF7.
PaxDbiQ53SF7.
PeptideAtlasiQ53SF7.
PRIDEiQ53SF7.

PTM databases

iPTMnetiQ53SF7.
PhosphoSitePlusiQ53SF7.

Expressioni

Gene expression databases

BgeeiENSG00000082438.
CleanExiHS_COBLL1.
ExpressionAtlasiQ53SF7. baseline and differential.
GenevisibleiQ53SF7. HS.

Organism-specific databases

HPAiHPA044933.
HPA053344.

Interactioni

GO - Molecular functioni

  • actin monomer binding Source: GO_Central
  • cadherin binding involved in cell-cell adhesion Source: BHF-UCL

Protein-protein interaction databases

BioGridi116511. 19 interactors.
IntActiQ53SF7. 19 interactors.
STRINGi9606.ENSP00000341360.

Structurei

Secondary structure

11204
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi185 – 191Combined sources7
Turni192 – 194Combined sources3
Beta strandi195 – 201Combined sources7
Beta strandi203 – 205Combined sources3
Helixi207 – 217Combined sources11
Beta strandi224 – 229Combined sources6
Helixi243 – 246Combined sources4
Beta strandi249 – 255Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DAJNMR-A182-259[»]
ProteinModelPortaliQ53SF7.
SMRiQ53SF7.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ53SF7.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1157 – 1177WH2PROSITE-ProRule annotationAdd BLAST21

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi329 – 334KKRRAP 16
Motifi398 – 403KKRRAP 26

Sequence similaritiesi

Contains 1 WH2 domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IIGI. Eukaryota.
ENOG4111I5R. LUCA.
GeneTreeiENSGT00530000063608.
HOVERGENiHBG105908.
InParanoidiQ53SF7.
OMAiMQDAAIQ.
OrthoDBiEOG091G01LF.
PhylomeDBiQ53SF7.
TreeFamiTF333490.

Family and domain databases

InterProiIPR019025. Cordon-bleu_ubiquitin_domain.
IPR003124. WH2_dom.
[Graphical view]
PfamiPF09469. Cobl. 1 hit.
[Graphical view]
PROSITEiPS51082. WH2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q53SF7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MCGRAAEAAA SSRTPGREMG QAVTRRLGAG ARAAPRRAMD GRTPRPQDAP
60 70 80 90 100
ARRKPKAKAP LPPAETKYTD VSSAADSVES TAFIMEQKEN MIDKDVELSV
110 120 130 140 150
VLPGDIIKST TVHGSKPMMD LLIFLCAQYH LNPSSYTIDL LSAEQNHIKF
160 170 180 190 200
KPNTPIGMLE VEKVILKPKM LDKKKPTPII PEKTVRVVIN FKKTQKTIVR
210 220 230 240 250
VSPHASLQEL APIICSKCEF DPLHTLLLKD YQSQEPLDLT KSLNDLGLRE
260 270 280 290 300
LYAMDVNRES CQISQNLDIM KEKENKGFFS FFQRSKKKRD QTASAPATPL
310 320 330 340 350
VNKHRPTFTR SNTISKPYIS NTLPSDAPKK RRAPLPPMPA SQSVPQDLAH
360 370 380 390 400
IQERPASCIV KSMSVDETDK SPCEAGRVRA GSLQLSSMSA GNSSLRRTKR
410 420 430 440 450
KAPSPPSKIP PHQSDENSRV TALQPVDGVP PDSASEANSP EELSSPETFH
460 470 480 490 500
PGLSSQEQCT APKLMEETSV FECPGTPEAA ITSLTSGISS DYSLEEIDEK
510 520 530 540 550
EELSEVPKVE AENISPKSQD IPFVSTDIIN TLKNDPDSAL GNGSGEFSQN
560 570 580 590 600
SMEEKQETKS TDGQEPHSVV YDTSNGKKVV DSIRNLKSLG PNQENVQNEI
610 620 630 640 650
IVYPENTEDN MKNGVKKTEI NVEGVAKNNN IDMEVERPSN SEAHETDTAI
660 670 680 690 700
SYKENHLAAS SVPDQKLNQP SAEKTKDAAI QTTPSCNSFD GKHQDHNLSD
710 720 730 740 750
SKVEECVQTS NNNISTQHSC LSSQDSVNTS REFRSQGTLI IHSEDPLTVK
760 770 780 790 800
DPICAHGNDD LLPPVDRIDK NSTASYLKNY PLYRQDYNPK PKPSNEITRE
810 820 830 840 850
YIPKIGMTTY KIVPPKSLEI SKDWQSETIE YKDDQDMHAL GKKHTHENVK
860 870 880 890 900
ETAIQTEDSA ISESPEEPLP NLKPKPNLRT EHQVPSSVSS PDDAMVSPLK
910 920 930 940 950
PAPKMTRDTG TAPFAPNLEE INNILESKFK SRASNAQAKP SSFFLQMQKR
960 970 980 990 1000
VSGHYVTSAA AKSVHAAPNP APKELTNKEA ERDMLPSPEQ TLSPLSKMPH
1010 1020 1030 1040 1050
SVPQPLVEKT DDDVIGQAPA EASPPPIAPK PVTIPASQVS TQNLKTLKTF
1060 1070 1080 1090 1100
GAPRPYSSSG PSPFALAVVK RSQSFSKERT ESPSASALVQ PPANTEEGKT
1110 1120 1130 1140 1150
HSVNKFVDIP QLGVSDKENN SAHNEQNSQI PTPTDGPSFT VMRQSSLTFQ
1160 1170 1180 1190 1200
SSDPEQMRQS LLTAIRSGEA AAKLKRVTIP SNTISVNGRS RLSHSMSPDA

QDGH
Length:1,204
Mass (Da):131,787
Last modified:November 28, 2006 - v2
Checksum:i6BA6F2ADF3440670
GO
Isoform 2 (identifier: Q53SF7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     447-486: ETFHPGLSSQEQCTAPKLMEETSVFECPGTPEAAITSLTS → A
     595-595: N → NV

Show »
Length:1,166
Mass (Da):127,719
Checksum:i0FBC2D76FA27E9B6
GO
Isoform 3 (identifier: Q53SF7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: Missing.

Show »
Length:1,166
Mass (Da):127,935
Checksum:i25D9282A915026E6
GO
Isoform 4 (identifier: Q53SF7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: Missing.
     447-486: ETFHPGLSSQEQCTAPKLMEETSVFECPGTPEAAITSLTS → A
     595-595: N → NV

Show »
Length:1,128
Mass (Da):123,868
Checksum:iB0BC3812F4BA93E8
GO
Isoform 5 (identifier: Q53SF7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: Missing.
     115-144: SKPMMDLLIFLCAQYHLNPSSYTIDLLSAE → RYAGVNEISGPPLLIPPLKVSVIYVLMFVL
     145-1204: Missing.

Show »
Length:106
Mass (Da):11,516
Checksum:i5922939ACD3632B9
GO

Sequence cautioni

The sequence BAA76821 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAB43215 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti368T → A in AAH71588 (PubMed:15489334).Curated1
Sequence conflicti845T → G in CAB43215 (PubMed:17974005).Curated1
Sequence conflicti947M → T in CAD97877 (PubMed:17974005).Curated1
Sequence conflicti1048K → E in AAH71588 (PubMed:15489334).Curated1
Sequence conflicti1095T → A in CAD97877 (PubMed:17974005).Curated1
Sequence conflicti1151S → G in CAB43215 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0216211 – 38Missing in isoform 3, isoform 4 and isoform 5. 3 PublicationsAdd BLAST38
Alternative sequenceiVSP_021622115 – 144SKPMM…LLSAE → RYAGVNEISGPPLLIPPLKV SVIYVLMFVL in isoform 5. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_021623145 – 1204Missing in isoform 5. 1 PublicationAdd BLAST1060
Alternative sequenceiVSP_021624447 – 486ETFHP…TSLTS → A in isoform 2 and isoform 4. 3 PublicationsAdd BLAST40
Alternative sequenceiVSP_021625595N → NV in isoform 2 and isoform 4. 3 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023194 mRNA. Translation: BAA76821.2. Different initiation.
AK225849 mRNA. No translation available.
AC019181 Genomic DNA. Translation: AAX93068.1.
CH471058 Genomic DNA. Translation: EAX11340.1.
BC006264 mRNA. Translation: AAH06264.1.
BC071588 mRNA. Translation: AAH71588.1.
AL049939 mRNA. Translation: CAB43215.1. Different initiation.
BX537877 mRNA. Translation: CAD97877.2.
CCDSiCCDS2223.2. [Q53SF7-3]
CCDS63045.1. [Q53SF7-4]
PIRiT08673.
RefSeqiNP_001265387.1. NM_001278458.1.
NP_001265389.1. NM_001278460.1.
NP_001265390.1. NM_001278461.1. [Q53SF7-4]
NP_055715.3. NM_014900.4. [Q53SF7-3]
UniGeneiHs.470457.
Hs.744314.

Genome annotation databases

EnsembliENST00000342193; ENSP00000341360; ENSG00000082438. [Q53SF7-3]
ENST00000375458; ENSP00000364607; ENSG00000082438. [Q53SF7-4]
ENST00000392717; ENSP00000376478; ENSG00000082438. [Q53SF7-1]
GeneIDi22837.
KEGGihsa:22837.
UCSCiuc002ucp.5. human. [Q53SF7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB023194 mRNA. Translation: BAA76821.2. Different initiation.
AK225849 mRNA. No translation available.
AC019181 Genomic DNA. Translation: AAX93068.1.
CH471058 Genomic DNA. Translation: EAX11340.1.
BC006264 mRNA. Translation: AAH06264.1.
BC071588 mRNA. Translation: AAH71588.1.
AL049939 mRNA. Translation: CAB43215.1. Different initiation.
BX537877 mRNA. Translation: CAD97877.2.
CCDSiCCDS2223.2. [Q53SF7-3]
CCDS63045.1. [Q53SF7-4]
PIRiT08673.
RefSeqiNP_001265387.1. NM_001278458.1.
NP_001265389.1. NM_001278460.1.
NP_001265390.1. NM_001278461.1. [Q53SF7-4]
NP_055715.3. NM_014900.4. [Q53SF7-3]
UniGeneiHs.470457.
Hs.744314.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DAJNMR-A182-259[»]
ProteinModelPortaliQ53SF7.
SMRiQ53SF7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116511. 19 interactors.
IntActiQ53SF7. 19 interactors.
STRINGi9606.ENSP00000341360.

PTM databases

iPTMnetiQ53SF7.
PhosphoSitePlusiQ53SF7.

Proteomic databases

MaxQBiQ53SF7.
PaxDbiQ53SF7.
PeptideAtlasiQ53SF7.
PRIDEiQ53SF7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000342193; ENSP00000341360; ENSG00000082438. [Q53SF7-3]
ENST00000375458; ENSP00000364607; ENSG00000082438. [Q53SF7-4]
ENST00000392717; ENSP00000376478; ENSG00000082438. [Q53SF7-1]
GeneIDi22837.
KEGGihsa:22837.
UCSCiuc002ucp.5. human. [Q53SF7-1]

Organism-specific databases

CTDi22837.
DisGeNETi22837.
GeneCardsiCOBLL1.
HGNCiHGNC:23571. COBLL1.
HPAiHPA044933.
HPA053344.
MIMi610318. gene.
neXtProtiNX_Q53SF7.
OpenTargetsiENSG00000082438.
PharmGKBiPA134990267.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IIGI. Eukaryota.
ENOG4111I5R. LUCA.
GeneTreeiENSGT00530000063608.
HOVERGENiHBG105908.
InParanoidiQ53SF7.
OMAiMQDAAIQ.
OrthoDBiEOG091G01LF.
PhylomeDBiQ53SF7.
TreeFamiTF333490.

Miscellaneous databases

ChiTaRSiCOBLL1. human.
EvolutionaryTraceiQ53SF7.
GeneWikiiCOBLL1.
GenomeRNAii22837.
PROiQ53SF7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000082438.
CleanExiHS_COBLL1.
ExpressionAtlasiQ53SF7. baseline and differential.
GenevisibleiQ53SF7. HS.

Family and domain databases

InterProiIPR019025. Cordon-bleu_ubiquitin_domain.
IPR003124. WH2_dom.
[Graphical view]
PfamiPF09469. Cobl. 1 hit.
[Graphical view]
PROSITEiPS51082. WH2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCOBL1_HUMAN
AccessioniPrimary (citable) accession number: Q53SF7
Secondary accession number(s): A6NMZ3
, Q6IQ33, Q7Z3I6, Q9BRH4, Q9UG88, Q9Y2I3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: November 28, 2006
Last modified: November 2, 2016
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.