Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Folate transporter-like protein C2orf83

Gene

C2orf83

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Folate transporter-like protein C2orf83
Gene namesi
Name:C2orf83
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000042304.10.
HGNCiHGNC:25344. C2orf83.

Subcellular locationi

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164717149.

Polymorphism and mutation databases

BioMutaiC2orf83.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003205501 – 150Folate transporter-like protein C2orf83Add BLAST150

Proteomic databases

PaxDbiQ53S99.
PRIDEiQ53S99.

PTM databases

iPTMnetiQ53S99.

Expressioni

Gene expression databases

BgeeiENSG00000042304.
CleanExiHS_C2orf83.
GenevisibleiQ53S99. HS.

Organism-specific databases

HPAiHPA030319.

Interactioni

Protein-protein interaction databases

MINTiMINT-4722244.
STRINGi9606.ENSP00000264387.

Structurei

3D structure databases

ProteinModelPortaliQ53S99.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3810. Eukaryota.
ENOG410XT34. LUCA.
HOGENOMiHOG000111339.
InParanoidiQ53S99.
OMAiGHGLCHP.
OrthoDBiEOG091G0Q8D.
PhylomeDBiQ53S99.
TreeFamiTF341245.

Family and domain databases

InterProiView protein in InterPro
IPR002666. Folate_carrier.
PANTHERiPTHR10686. PTHR10686. 1 hit.
PfamiView protein in Pfam
PF01770. Folate_carrier. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q53S99-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDYALTFGI NPFIALMIQP IVTMTVVDNQ GLGLPVDIQH KAKPSPKASQ
60 70 80 90 100
MLPPDLGPPS FQNLLSPSEK LEPWDPGMRK LTVQTCGLTF IHPAGHGLCH
110 120 130 140 150
PTAEASAETL SSTALNRPSV REGACNEKST ENKKPQDSVL WSHSRWFQGN
Length:150
Mass (Da):16,373
Last modified:May 24, 2005 - v1
Checksum:i240FC8BFB6EB5B44
GO
Isoform 2 (identifier: Q53S99-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-150: LLSPSEKLEP...WSHSRWFQGN → CFTCRTAPSLVMVLSWKSGVRREVPVHPSYAKY

Note: No experimental confirmation available.
Show »
Length:96
Mass (Da):10,585
Checksum:i6D1771D64D60FFBE
GO

Sequence cautioni

Q53S99: The sequence CAB95774 differs from that shown. Reason: Erroneous termination at position 141. Translated as Trp.Curated
Q53S99: The sequence CAH18470 differs from that shown. Reason: Erroneous termination at position 141. Translated as Trp.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti11N → D in AK055355 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06186545S → L. Corresponds to variant dbSNP:rs28739019Ensembl.1
Natural variantiVAR_039201104E → Q2 PublicationsCorresponds to variant dbSNP:rs2138402Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04540364 – 150LLSPS…WFQGN → CFTCRTAPSLVMVLSWKSGV RREVPVHPSYAKY in isoform 2. 1 PublicationAdd BLAST87

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055355 mRNA. No translation available.
AL359944 mRNA. Translation: CAB95774.1. Sequence problems.
CR749679 mRNA. Translation: CAH18470.1. Sequence problems.
AC064853 Genomic DNA. Translation: AAX93156.1.
CH471063 Genomic DNA. Translation: EAW70873.1.
CH471063 Genomic DNA. Translation: EAW70874.1.
BC131618 mRNA. Translation: AAI31619.1.
CCDSiCCDS33388.1. [Q53S99-1]
CCDS54434.1. [Q53S99-2]
RefSeqiNP_001155955.1. NM_001162483.1. [Q53S99-2]
NP_064546.3. NM_020161.3. [Q53S99-1]
UniGeneiHs.283092.

Genome annotation databases

EnsembliENST00000264387; ENSP00000264387; ENSG00000042304. [Q53S99-1]
ENST00000409066; ENSP00000387149; ENSG00000042304. [Q53S99-2]
GeneIDi56918.
KEGGihsa:56918.
UCSCiuc002vph.4. human. [Q53S99-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCB083_HUMAN
AccessioniPrimary (citable) accession number: Q53S99
Secondary accession number(s): A2RRG6, B8ZZI8, Q9NPW4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: May 24, 2005
Last modified: October 25, 2017
This is version 83 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Although related to reduced folate carrier family, it lacks transmembrane domains, suggesting that it has probably no transporter function.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families