Q53R41 (FAKD1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 61.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: FAST kinase domain-containing protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 847 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Belongs to the FAST kinase family. Contains 1 RAP domain. |
| Caution | It is uncertain whether Met-1 or Met-15 is the initiator. |
| Sequence caution | The sequence AAH32687.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB15168.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Acetylation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cellular respiration Inferred from sequence or structural similarity PubMed 20869947. Source: UniProtKB protein phosphorylationInferred from electronic annotation. Source: GOC |
| Cellular_component | mitochondrion Inferred from direct assay PubMed 20869947. Source: UniProtKB |
| Molecular_function | protein kinase activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q53R41-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q53R41-2) The sequence of this isoform differs from the canonical sequence as follows: 649-692: ILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKG → S | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 847 | 847 | FAST kinase domain-containing protein 1 | PRO_0000284710 | |||||
Regions | |||||||||
| Domain | 777 – 837 | 61 | RAP | ||||||
Amino acid modifications | |||||||||
| Modified residue | 360 | 1 | N6-acetyllysine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 649 – 692 | 44 | ILSPS…QYNKG → S in isoform 2. | VSP_024617 | |||||
| Natural variant | 384 | 1 | E → Q. Corresponds to variant rs12618227 [ dbSNP | Ensembl ]. | VAR_031806 | |||||
| Natural variant | 446 | 1 | C → G. Corresponds to variant rs35106223 [ dbSNP | Ensembl ]. | VAR_031807 | |||||
| Natural variant | 467 | 1 | M → V. Ref.1 Ref.3 Corresponds to variant rs2253680 [ dbSNP | Ensembl ]. | VAR_031808 | |||||
Experimental info | |||||||||
| Sequence conflict | 213 | 1 | V → M in BAB85043. Ref.1 | ||||||
| Sequence conflict | 228 | 1 | V → A in BAB85043. Ref.1 | ||||||
| Sequence conflict | 288 | 1 | M → T in BAB15168. Ref.1 | ||||||
| Sequence conflict | 293 | 1 | L → P in BAB85043. Ref.1 | ||||||
| Sequence conflict | 756 | 1 | E → EMPWESNIEIVGSRLPPGAE RIALEFLDSKA in BAB47429. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 166-847 (ISOFORM 1), VARIANT VAL-467. Tissue: Mammary gland. |
| [2] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 93-847 (ISOFORM 1), VARIANT VAL-467. Tissue: Eye. |
| [4] | "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O. DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 142-847 (ISOFORM 1). Tissue: Brain. |
| [5] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-360, MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK025554 mRNA. Translation: BAB15168.1. Different initiation. AK055892 mRNA. Translation: BAB71037.1. AK074302 mRNA. Translation: BAB85043.1. AC093899 Genomic DNA. Translation: AAY24118.1. BC032687 mRNA. Translation: AAH32687.1. Different initiation. AB058703 mRNA. Translation: BAB47429.1. |
| IPI | IPI00289061. IPI00300186. |
| RefSeq | NP_078898.3. NM_024622.3. |
| UniGene | Hs.529276. |
3D structure databases | |
| ProteinModelPortal | Q53R41. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q53R41. 1 interaction. |
| STRING | 9606.ENSP00000400513. |
PTM databases | |
| PhosphoSite | Q53R41. |
Polymorphism databases | |
| DMDM | 74726532. |
Proteomic databases | |
| PaxDb | Q53R41. |
| PRIDE | Q53R41. |
Protocols and materials databases | |
| DNASU | 79675. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000453153; ENSP00000400513; ENSG00000138399. ENST00000453929; ENSP00000403229; ENSG00000138399. |
| GeneID | 79675. |
| KEGG | hsa:79675. |
| UCSC | uc002uev.4. human. uc002uex.4. human. |
Organism-specific databases | |
| CTD | 79675. |
| GeneCards | GC02M170386. |
| H-InvDB | HIX0002572. |
| HGNC | HGNC:26150. FASTKD1. |
| HPA | HPA043719. |
| neXtProt | NX_Q53R41. |
| PharmGKB | PA145148834. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG39093. |
| HOGENOM | HOG000293293. |
| HOVERGEN | HBG099520. |
| InParanoid | Q53R41. |
| OMA | GYRVIQI. |
| OrthoDB | EOG4FJ88B. |
Gene expression databases | |
| ArrayExpress | Q53R41. |
| Bgee | Q53R41. |
| CleanEx | HS_FASTKD1. |
| Genevestigator | Q53R41. |
Family and domain databases | |
| InterPro | IPR013579. FAST_2. IPR010622. FAST_Leu-rich. IPR013584. RAP. [Graphical view] |
| Pfam | PF06743. FAST_1. 1 hit. PF08368. FAST_2. 1 hit. PF08373. RAP. 1 hit. [Graphical view] |
| SMART | SM00952. RAP. 1 hit. [Graphical view] |
| PROSITE | PS51286. RAP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 79675. |
| NextBio | 68914. |
Entry information
| Entry name | FAKD1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q53R41 Secondary accession number(s): Q8N583 Q9H6T4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
