Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q53R41

- FAKD1_HUMAN

UniProt

Q53R41 - FAKD1_HUMAN

Protein

FAST kinase domain-containing protein 1

Gene

FASTKD1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 72 (01 Oct 2014)
      Sequence version 1 (24 May 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. poly(A) RNA binding Source: UniProtKB
    2. protein kinase activity Source: InterPro

    GO - Biological processi

    1. cellular respiration Source: UniProtKB

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    FAST kinase domain-containing protein 1
    Gene namesi
    Name:FASTKD1
    Synonyms:KIAA1800
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:26150. FASTKD1.

    Subcellular locationi

    GO - Cellular componenti

    1. mitochondrion Source: UniProtKB

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA145148834.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 847847FAST kinase domain-containing protein 1PRO_0000284710Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei360 – 3601N6-acetyllysine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ53R41.
    PaxDbiQ53R41.
    PRIDEiQ53R41.

    PTM databases

    PhosphoSiteiQ53R41.

    Expressioni

    Gene expression databases

    ArrayExpressiQ53R41.
    BgeeiQ53R41.
    CleanExiHS_FASTKD1.
    GenevestigatoriQ53R41.

    Organism-specific databases

    HPAiHPA043719.

    Interactioni

    Protein-protein interaction databases

    BioGridi122800. 1 interaction.
    IntActiQ53R41. 2 interactions.
    MINTiMINT-8051772.
    STRINGi9606.ENSP00000400513.

    Structurei

    3D structure databases

    ProteinModelPortaliQ53R41.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini777 – 83761RAPPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the FAST kinase family.Curated
    Contains 1 RAP domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG39093.
    HOGENOMiHOG000293293.
    HOVERGENiHBG099520.
    InParanoidiQ53R41.
    OMAiDHPQFLT.
    OrthoDBiEOG7TBC2C.
    PhylomeDBiQ53R41.
    TreeFamiTF324885.

    Family and domain databases

    InterProiIPR013579. FAST_2.
    IPR010622. FAST_Leu-rich.
    IPR013584. RAP.
    [Graphical view]
    PfamiPF06743. FAST_1. 1 hit.
    PF08368. FAST_2. 1 hit.
    PF08373. RAP. 1 hit.
    [Graphical view]
    SMARTiSM00952. RAP. 1 hit.
    [Graphical view]
    PROSITEiPS51286. RAP. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q53R41-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKKTPVFLES LVTNMLRLRA ICPFSWRVFQ FRPISCEPLI IQMNKCTDEE    50
    QMFGFIERNK AILSEKQVGC AFDMLWKLQK QKTSLLKNAE YVRDHPQFLT 100
    LHNLATNKFK LMNDDTLVNV LYVTQQFAGE AHDPLVEALV TEAWRRLERF 150
    DIKLLSEFSS CLADQHLYFS PLMGKIADIV HRNLETTQDL SSLSVLMVNI 200
    SSLISRHFQQ QLVNKTELLF DTIDSSEVNV AKSIAKFLRN VRYRYQPLLE 250
    RCNNVFLSNV DHLDLDSISK ILSVYKFLQF NSFEFIIMAK KKLTEMIPLC 300
    NHPASFVKLF VALGPIAGPE EKKQLKSTML LMSEDLTGEQ ALAVLGAMGD 350
    MESRNSCLIK RVTSVLHKHL DGYKPLELLK ITQELTFLHF QRKEFFAKLR 400
    ELLLSYLKNS FIPTEVSVLV RAISLLPSPH LDEVGISRIE AVLPQCDLNN 450
    LSSFATSVLR WIQHDHMYLD NMTAKQLKLL QKLDHYGRQR LQHSNSLDLL 500
    RKELKSLKGN TFPESLLEEM IATLQHFMDD INYINVGEIA SFISSTDYLS 550
    TLLLDRIASV AVQQIEKIHP FTIPAIIRPF SVLNYDPPQR DEFLGTCVQH 600
    LNSYLGILDP FILVFLGFSL ATLEYFPEDL LKAIFNIKFL ARLDSQLEIL 650
    SPSRSARVQF HLMELNRSVC LECPEFQIPW FHDRFCQQYN KGIGGMDGTQ 700
    QQIFKMLAEV LGGINCVKAS VLTPYYHKVD FECILDKRKK PLPYGSHNIA 750
    LGQLPEMPWE SNIEIVGSRL PPGAERIALE FLDSKALCRN IPHMKGKSAM 800
    KKRHLEILGY RVIQISQFEW NSMALSTKDA RMDYLRECIF GEVKSCL 847
    Length:847
    Mass (Da):97,411
    Last modified:May 24, 2005 - v1
    Checksum:i5026A635048EB0B3
    GO
    Isoform 2 (identifier: Q53R41-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         649-692: ILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKG → S

    Note: No experimental confirmation available.

    Show »
    Length:804
    Mass (Da):92,204
    Checksum:i1026298B7060A369
    GO

    Sequence cautioni

    The sequence AAH32687.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB15168.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti213 – 2131V → M in BAB85043. (PubMed:14702039)Curated
    Sequence conflicti228 – 2281V → A in BAB85043. (PubMed:14702039)Curated
    Sequence conflicti288 – 2881M → T in BAB15168. (PubMed:14702039)Curated
    Sequence conflicti293 – 2931L → P in BAB85043. (PubMed:14702039)Curated
    Sequence conflicti756 – 7561E → EMPWESNIEIVGSRLPPGAE RIALEFLDSKA in BAB47429. (PubMed:11347906)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti384 – 3841E → Q.
    Corresponds to variant rs12618227 [ dbSNP | Ensembl ].
    VAR_031806
    Natural varianti446 – 4461C → G.
    Corresponds to variant rs35106223 [ dbSNP | Ensembl ].
    VAR_031807
    Natural varianti467 – 4671M → V.2 Publications
    Corresponds to variant rs2253680 [ dbSNP | Ensembl ].
    VAR_031808

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei649 – 69244ILSPS…QYNKG → S in isoform 2. 1 PublicationVSP_024617Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK025554 mRNA. Translation: BAB15168.1. Different initiation.
    AK055892 mRNA. Translation: BAB71037.1.
    AK074302 mRNA. Translation: BAB85043.1.
    AC093899 Genomic DNA. Translation: AAY24118.1.
    BC032687 mRNA. Translation: AAH32687.1. Different initiation.
    AB058703 mRNA. Translation: BAB47429.1.
    CCDSiCCDS33318.1. [Q53R41-1]
    CCDS63051.1. [Q53R41-2]
    RefSeqiNP_001268405.1. NM_001281476.1. [Q53R41-2]
    NP_078898.3. NM_024622.4. [Q53R41-1]
    UniGeneiHs.529276.

    Genome annotation databases

    EnsembliENST00000453153; ENSP00000400513; ENSG00000138399. [Q53R41-1]
    ENST00000453929; ENSP00000403229; ENSG00000138399. [Q53R41-2]
    GeneIDi79675.
    KEGGihsa:79675.
    UCSCiuc002uev.4. human. [Q53R41-1]
    uc002uex.5. human. [Q53R41-2]

    Polymorphism databases

    DMDMi74726532.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK025554 mRNA. Translation: BAB15168.1 . Different initiation.
    AK055892 mRNA. Translation: BAB71037.1 .
    AK074302 mRNA. Translation: BAB85043.1 .
    AC093899 Genomic DNA. Translation: AAY24118.1 .
    BC032687 mRNA. Translation: AAH32687.1 . Different initiation.
    AB058703 mRNA. Translation: BAB47429.1 .
    CCDSi CCDS33318.1. [Q53R41-1 ]
    CCDS63051.1. [Q53R41-2 ]
    RefSeqi NP_001268405.1. NM_001281476.1. [Q53R41-2 ]
    NP_078898.3. NM_024622.4. [Q53R41-1 ]
    UniGenei Hs.529276.

    3D structure databases

    ProteinModelPortali Q53R41.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122800. 1 interaction.
    IntActi Q53R41. 2 interactions.
    MINTi MINT-8051772.
    STRINGi 9606.ENSP00000400513.

    PTM databases

    PhosphoSitei Q53R41.

    Polymorphism databases

    DMDMi 74726532.

    Proteomic databases

    MaxQBi Q53R41.
    PaxDbi Q53R41.
    PRIDEi Q53R41.

    Protocols and materials databases

    DNASUi 79675.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000453153 ; ENSP00000400513 ; ENSG00000138399 . [Q53R41-1 ]
    ENST00000453929 ; ENSP00000403229 ; ENSG00000138399 . [Q53R41-2 ]
    GeneIDi 79675.
    KEGGi hsa:79675.
    UCSCi uc002uev.4. human. [Q53R41-1 ]
    uc002uex.5. human. [Q53R41-2 ]

    Organism-specific databases

    CTDi 79675.
    GeneCardsi GC02M170386.
    H-InvDB HIX0002572.
    HGNCi HGNC:26150. FASTKD1.
    HPAi HPA043719.
    neXtProti NX_Q53R41.
    PharmGKBi PA145148834.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG39093.
    HOGENOMi HOG000293293.
    HOVERGENi HBG099520.
    InParanoidi Q53R41.
    OMAi DHPQFLT.
    OrthoDBi EOG7TBC2C.
    PhylomeDBi Q53R41.
    TreeFami TF324885.

    Miscellaneous databases

    GenomeRNAii 79675.
    NextBioi 68914.
    PROi Q53R41.

    Gene expression databases

    ArrayExpressi Q53R41.
    Bgeei Q53R41.
    CleanExi HS_FASTKD1.
    Genevestigatori Q53R41.

    Family and domain databases

    InterProi IPR013579. FAST_2.
    IPR010622. FAST_Leu-rich.
    IPR013584. RAP.
    [Graphical view ]
    Pfami PF06743. FAST_1. 1 hit.
    PF08368. FAST_2. 1 hit.
    PF08373. RAP. 1 hit.
    [Graphical view ]
    SMARTi SM00952. RAP. 1 hit.
    [Graphical view ]
    PROSITEi PS51286. RAP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 166-847 (ISOFORM 1), VARIANT VAL-467.
      Tissue: Mammary gland.
    2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 93-847 (ISOFORM 1), VARIANT VAL-467.
      Tissue: Eye.
    4. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
      DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 142-847 (ISOFORM 1).
      Tissue: Brain.
    5. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
      Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
      Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-360, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiFAKD1_HUMAN
    AccessioniPrimary (citable) accession number: Q53R41
    Secondary accession number(s): Q8N583
    , Q8TEA9, Q96JM5, Q96N71, Q9H6T4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 17, 2007
    Last sequence update: May 24, 2005
    Last modified: October 1, 2014
    This is version 72 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3