SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q53R41

- FAKD1_HUMAN

UniProt

Q53R41 - FAKD1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
FAST kinase domain-containing protein 1
Gene
FASTKD1, KIAA1800
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. poly(A) RNA binding Source: UniProtKB
  2. protein kinase activity Source: InterPro

GO - Biological processi

  1. cellular respiration Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
FAST kinase domain-containing protein 1
Gene namesi
Name:FASTKD1
Synonyms:KIAA1800
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:26150. FASTKD1.

Subcellular locationi

GO - Cellular componenti

  1. mitochondrion Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145148834.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 847847FAST kinase domain-containing protein 1
PRO_0000284710Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei360 – 3601N6-acetyllysine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ53R41.
PaxDbiQ53R41.
PRIDEiQ53R41.

PTM databases

PhosphoSiteiQ53R41.

Expressioni

Gene expression databases

ArrayExpressiQ53R41.
BgeeiQ53R41.
CleanExiHS_FASTKD1.
GenevestigatoriQ53R41.

Organism-specific databases

HPAiHPA043719.

Interactioni

Protein-protein interaction databases

BioGridi122800. 1 interaction.
IntActiQ53R41. 2 interactions.
MINTiMINT-8051772.
STRINGi9606.ENSP00000400513.

Structurei

3D structure databases

ProteinModelPortaliQ53R41.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini777 – 83761RAP
Add
BLAST

Sequence similaritiesi

Belongs to the FAST kinase family.
Contains 1 RAP domain.

Phylogenomic databases

eggNOGiNOG39093.
HOGENOMiHOG000293293.
HOVERGENiHBG099520.
InParanoidiQ53R41.
OMAiDHPQFLT.
OrthoDBiEOG7TBC2C.
PhylomeDBiQ53R41.
TreeFamiTF324885.

Family and domain databases

InterProiIPR013579. FAST_2.
IPR010622. FAST_Leu-rich.
IPR013584. RAP.
[Graphical view]
PfamiPF06743. FAST_1. 1 hit.
PF08368. FAST_2. 1 hit.
PF08373. RAP. 1 hit.
[Graphical view]
SMARTiSM00952. RAP. 1 hit.
[Graphical view]
PROSITEiPS51286. RAP. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q53R41-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKKTPVFLES LVTNMLRLRA ICPFSWRVFQ FRPISCEPLI IQMNKCTDEE    50
QMFGFIERNK AILSEKQVGC AFDMLWKLQK QKTSLLKNAE YVRDHPQFLT 100
LHNLATNKFK LMNDDTLVNV LYVTQQFAGE AHDPLVEALV TEAWRRLERF 150
DIKLLSEFSS CLADQHLYFS PLMGKIADIV HRNLETTQDL SSLSVLMVNI 200
SSLISRHFQQ QLVNKTELLF DTIDSSEVNV AKSIAKFLRN VRYRYQPLLE 250
RCNNVFLSNV DHLDLDSISK ILSVYKFLQF NSFEFIIMAK KKLTEMIPLC 300
NHPASFVKLF VALGPIAGPE EKKQLKSTML LMSEDLTGEQ ALAVLGAMGD 350
MESRNSCLIK RVTSVLHKHL DGYKPLELLK ITQELTFLHF QRKEFFAKLR 400
ELLLSYLKNS FIPTEVSVLV RAISLLPSPH LDEVGISRIE AVLPQCDLNN 450
LSSFATSVLR WIQHDHMYLD NMTAKQLKLL QKLDHYGRQR LQHSNSLDLL 500
RKELKSLKGN TFPESLLEEM IATLQHFMDD INYINVGEIA SFISSTDYLS 550
TLLLDRIASV AVQQIEKIHP FTIPAIIRPF SVLNYDPPQR DEFLGTCVQH 600
LNSYLGILDP FILVFLGFSL ATLEYFPEDL LKAIFNIKFL ARLDSQLEIL 650
SPSRSARVQF HLMELNRSVC LECPEFQIPW FHDRFCQQYN KGIGGMDGTQ 700
QQIFKMLAEV LGGINCVKAS VLTPYYHKVD FECILDKRKK PLPYGSHNIA 750
LGQLPEMPWE SNIEIVGSRL PPGAERIALE FLDSKALCRN IPHMKGKSAM 800
KKRHLEILGY RVIQISQFEW NSMALSTKDA RMDYLRECIF GEVKSCL 847
Length:847
Mass (Da):97,411
Last modified:May 24, 2005 - v1
Checksum:i5026A635048EB0B3
GO
Isoform 2 (identifier: Q53R41-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     649-692: ILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKG → S

Note: No experimental confirmation available.

Show »
Length:804
Mass (Da):92,204
Checksum:i1026298B7060A369
GO

Sequence cautioni

The sequence AAH32687.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAB15168.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti384 – 3841E → Q.
Corresponds to variant rs12618227 [ dbSNP | Ensembl ].
VAR_031806
Natural varianti446 – 4461C → G.
Corresponds to variant rs35106223 [ dbSNP | Ensembl ].
VAR_031807
Natural varianti467 – 4671M → V.2 Publications
Corresponds to variant rs2253680 [ dbSNP | Ensembl ].
VAR_031808

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei649 – 69244ILSPS…QYNKG → S in isoform 2.
VSP_024617Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti213 – 2131V → M in BAB85043. 1 Publication
Sequence conflicti228 – 2281V → A in BAB85043. 1 Publication
Sequence conflicti288 – 2881M → T in BAB15168. 1 Publication
Sequence conflicti293 – 2931L → P in BAB85043. 1 Publication
Sequence conflicti756 – 7561E → EMPWESNIEIVGSRLPPGAE RIALEFLDSKA in BAB47429. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK025554 mRNA. Translation: BAB15168.1. Different initiation.
AK055892 mRNA. Translation: BAB71037.1.
AK074302 mRNA. Translation: BAB85043.1.
AC093899 Genomic DNA. Translation: AAY24118.1.
BC032687 mRNA. Translation: AAH32687.1. Different initiation.
AB058703 mRNA. Translation: BAB47429.1.
CCDSiCCDS33318.1. [Q53R41-1]
CCDS63051.1. [Q53R41-2]
RefSeqiNP_001268405.1. NM_001281476.1. [Q53R41-2]
NP_078898.3. NM_024622.4. [Q53R41-1]
UniGeneiHs.529276.

Genome annotation databases

EnsembliENST00000453153; ENSP00000400513; ENSG00000138399. [Q53R41-1]
ENST00000453929; ENSP00000403229; ENSG00000138399. [Q53R41-2]
GeneIDi79675.
KEGGihsa:79675.
UCSCiuc002uev.4. human. [Q53R41-1]
uc002uex.5. human. [Q53R41-2]

Polymorphism databases

DMDMi74726532.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK025554 mRNA. Translation: BAB15168.1 . Different initiation.
AK055892 mRNA. Translation: BAB71037.1 .
AK074302 mRNA. Translation: BAB85043.1 .
AC093899 Genomic DNA. Translation: AAY24118.1 .
BC032687 mRNA. Translation: AAH32687.1 . Different initiation.
AB058703 mRNA. Translation: BAB47429.1 .
CCDSi CCDS33318.1. [Q53R41-1 ]
CCDS63051.1. [Q53R41-2 ]
RefSeqi NP_001268405.1. NM_001281476.1. [Q53R41-2 ]
NP_078898.3. NM_024622.4. [Q53R41-1 ]
UniGenei Hs.529276.

3D structure databases

ProteinModelPortali Q53R41.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122800. 1 interaction.
IntActi Q53R41. 2 interactions.
MINTi MINT-8051772.
STRINGi 9606.ENSP00000400513.

PTM databases

PhosphoSitei Q53R41.

Polymorphism databases

DMDMi 74726532.

Proteomic databases

MaxQBi Q53R41.
PaxDbi Q53R41.
PRIDEi Q53R41.

Protocols and materials databases

DNASUi 79675.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000453153 ; ENSP00000400513 ; ENSG00000138399 . [Q53R41-1 ]
ENST00000453929 ; ENSP00000403229 ; ENSG00000138399 . [Q53R41-2 ]
GeneIDi 79675.
KEGGi hsa:79675.
UCSCi uc002uev.4. human. [Q53R41-1 ]
uc002uex.5. human. [Q53R41-2 ]

Organism-specific databases

CTDi 79675.
GeneCardsi GC02M170386.
H-InvDB HIX0002572.
HGNCi HGNC:26150. FASTKD1.
HPAi HPA043719.
neXtProti NX_Q53R41.
PharmGKBi PA145148834.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG39093.
HOGENOMi HOG000293293.
HOVERGENi HBG099520.
InParanoidi Q53R41.
OMAi DHPQFLT.
OrthoDBi EOG7TBC2C.
PhylomeDBi Q53R41.
TreeFami TF324885.

Miscellaneous databases

GenomeRNAii 79675.
NextBioi 68914.
PROi Q53R41.

Gene expression databases

ArrayExpressi Q53R41.
Bgeei Q53R41.
CleanExi HS_FASTKD1.
Genevestigatori Q53R41.

Family and domain databases

InterProi IPR013579. FAST_2.
IPR010622. FAST_Leu-rich.
IPR013584. RAP.
[Graphical view ]
Pfami PF06743. FAST_1. 1 hit.
PF08368. FAST_2. 1 hit.
PF08373. RAP. 1 hit.
[Graphical view ]
SMARTi SM00952. RAP. 1 hit.
[Graphical view ]
PROSITEi PS51286. RAP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 166-847 (ISOFORM 1), VARIANT VAL-467.
    Tissue: Mammary gland.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 93-847 (ISOFORM 1), VARIANT VAL-467.
    Tissue: Eye.
  4. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
    DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 142-847 (ISOFORM 1).
    Tissue: Brain.
  5. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-360, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiFAKD1_HUMAN
AccessioniPrimary (citable) accession number: Q53R41
Secondary accession number(s): Q8N583
, Q8TEA9, Q96JM5, Q96N71, Q9H6T4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: May 24, 2005
Last modified: July 9, 2014
This is version 71 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi