Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FAST kinase domain-containing protein 1, mitochondrial

Gene

FASTKD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulates the stability of mitochondrial MT-ND3 mRNA (PubMed:28335001).1 Publication

Caution

It is uncertain whether Met-1 or Met-15 is the initiator.Curated

GO - Molecular functioni

GO - Biological processi

  • cellular respiration Source: UniProtKB
  • mitochondrial RNA metabolic process Source: UniProtKB
  • regulation of mitochondrial mRNA stability Source: UniProtKB

Names & Taxonomyi

Protein namesi
Recommended name:
FAST kinase domain-containing protein 1, mitochondrial
Gene namesi
Name:FASTKD1
Synonyms:KIAA1800
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000138399.17
HGNCiHGNC:26150 FASTKD1
MIMi617529 gene
neXtProtiNX_Q53R41

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000138399
PharmGKBiPA145148834

Polymorphism and mutation databases

BioMutaiFASTKD1
DMDMi74726532

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_0000284710? – 847FAST kinase domain-containing protein 1, mitochondrial
Transit peptidei1 – ?MitochondrionCurated

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei360N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ53R41
MaxQBiQ53R41
PaxDbiQ53R41
PeptideAtlasiQ53R41
PRIDEiQ53R41

PTM databases

iPTMnetiQ53R41
PhosphoSitePlusiQ53R41

Expressioni

Tissue specificityi

Expression detected in spleen, thymus, testis, ovary, colon, heart, smooth muscle, kidney, brain, lung, liver and white adipose tissue with highest expression in heart.1 Publication

Gene expression databases

BgeeiENSG00000138399
CleanExiHS_FASTKD1
ExpressionAtlasiQ53R41 baseline and differential
GenevisibleiQ53R41 HS

Organism-specific databases

HPAiHPA043719

Interactioni

Protein-protein interaction databases

BioGridi122800, 17 interactors
IntActiQ53R41, 2 interactors
MINTiQ53R41

Structurei

3D structure databases

ProteinModelPortaliQ53R41
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini777 – 837RAPPROSITE-ProRule annotationAdd BLAST61

Domaini

The RAP domain is essential to regulate MT-ND3 mRNA levels.1 Publication

Sequence similaritiesi

Belongs to the FAST kinase family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiENOG410IHTE Eukaryota
ENOG410Z496 LUCA
GeneTreeiENSGT00530000063266
HOGENOMiHOG000293293
HOVERGENiHBG099520
InParanoidiQ53R41
OMAiDHPQFLT
OrthoDBiEOG091G0WV6
PhylomeDBiQ53R41
TreeFamiTF324885

Family and domain databases

InterProiView protein in InterPro
IPR013579 FAST_2
IPR010622 FAST_Leu-rich
IPR013584 RAP
PfamiView protein in Pfam
PF06743 FAST_1, 1 hit
PF08368 FAST_2, 1 hit
PF08373 RAP, 1 hit
SMARTiView protein in SMART
SM00952 RAP, 1 hit
PROSITEiView protein in PROSITE
PS51286 RAP, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q53R41-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKKTPVFLES LVTNMLRLRA ICPFSWRVFQ FRPISCEPLI IQMNKCTDEE
60 70 80 90 100
QMFGFIERNK AILSEKQVGC AFDMLWKLQK QKTSLLKNAE YVRDHPQFLT
110 120 130 140 150
LHNLATNKFK LMNDDTLVNV LYVTQQFAGE AHDPLVEALV TEAWRRLERF
160 170 180 190 200
DIKLLSEFSS CLADQHLYFS PLMGKIADIV HRNLETTQDL SSLSVLMVNI
210 220 230 240 250
SSLISRHFQQ QLVNKTELLF DTIDSSEVNV AKSIAKFLRN VRYRYQPLLE
260 270 280 290 300
RCNNVFLSNV DHLDLDSISK ILSVYKFLQF NSFEFIIMAK KKLTEMIPLC
310 320 330 340 350
NHPASFVKLF VALGPIAGPE EKKQLKSTML LMSEDLTGEQ ALAVLGAMGD
360 370 380 390 400
MESRNSCLIK RVTSVLHKHL DGYKPLELLK ITQELTFLHF QRKEFFAKLR
410 420 430 440 450
ELLLSYLKNS FIPTEVSVLV RAISLLPSPH LDEVGISRIE AVLPQCDLNN
460 470 480 490 500
LSSFATSVLR WIQHDHMYLD NMTAKQLKLL QKLDHYGRQR LQHSNSLDLL
510 520 530 540 550
RKELKSLKGN TFPESLLEEM IATLQHFMDD INYINVGEIA SFISSTDYLS
560 570 580 590 600
TLLLDRIASV AVQQIEKIHP FTIPAIIRPF SVLNYDPPQR DEFLGTCVQH
610 620 630 640 650
LNSYLGILDP FILVFLGFSL ATLEYFPEDL LKAIFNIKFL ARLDSQLEIL
660 670 680 690 700
SPSRSARVQF HLMELNRSVC LECPEFQIPW FHDRFCQQYN KGIGGMDGTQ
710 720 730 740 750
QQIFKMLAEV LGGINCVKAS VLTPYYHKVD FECILDKRKK PLPYGSHNIA
760 770 780 790 800
LGQLPEMPWE SNIEIVGSRL PPGAERIALE FLDSKALCRN IPHMKGKSAM
810 820 830 840
KKRHLEILGY RVIQISQFEW NSMALSTKDA RMDYLRECIF GEVKSCL
Length:847
Mass (Da):97,411
Last modified:May 24, 2005 - v1
Checksum:i5026A635048EB0B3
GO
Isoform 2 (identifier: Q53R41-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     649-692: ILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKG → S

Note: No experimental confirmation available.
Show »
Length:804
Mass (Da):92,204
Checksum:i1026298B7060A369
GO

Sequence cautioni

The sequence AAH32687 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB15168 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti213V → M in BAB85043 (PubMed:14702039).Curated1
Sequence conflicti228V → A in BAB85043 (PubMed:14702039).Curated1
Sequence conflicti288M → T in BAB15168 (PubMed:14702039).Curated1
Sequence conflicti293L → P in BAB85043 (PubMed:14702039).Curated1
Sequence conflicti756E → EMPWESNIEIVGSRLPPGAE RIALEFLDSKA in BAB47429 (PubMed:11347906).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_031806384E → Q. Corresponds to variant dbSNP:rs12618227Ensembl.1
Natural variantiVAR_031807446C → G. Corresponds to variant dbSNP:rs35106223Ensembl.1
Natural variantiVAR_031808467M → V2 PublicationsCorresponds to variant dbSNP:rs2253680Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024617649 – 692ILSPS…QYNKG → S in isoform 2. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK025554 mRNA Translation: BAB15168.1 Different initiation.
AK055892 mRNA Translation: BAB71037.1
AK074302 mRNA Translation: BAB85043.1
AC093899 Genomic DNA Translation: AAY24118.1
BC032687 mRNA Translation: AAH32687.1 Different initiation.
AB058703 mRNA Translation: BAB47429.1
CCDSiCCDS33318.1 [Q53R41-1]
CCDS63051.1 [Q53R41-2]
RefSeqiNP_001268405.1, NM_001281476.2 [Q53R41-2]
NP_001308975.1, NM_001322046.1 [Q53R41-1]
NP_001308977.1, NM_001322048.1
NP_001308978.1, NM_001322049.1
NP_078898.3, NM_024622.5 [Q53R41-1]
XP_016860400.1, XM_017004911.1
UniGeneiHs.529276

Genome annotation databases

EnsembliENST00000453153; ENSP00000400513; ENSG00000138399 [Q53R41-1]
ENST00000453929; ENSP00000403229; ENSG00000138399 [Q53R41-2]
GeneIDi79675
KEGGihsa:79675
UCSCiuc002uev.6 human [Q53R41-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiFAKD1_HUMAN
AccessioniPrimary (citable) accession number: Q53R41
Secondary accession number(s): Q8N583
, Q8TEA9, Q96JM5, Q96N71, Q9H6T4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: May 24, 2005
Last modified: April 25, 2018
This is version 98 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health