Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FAST kinase domain-containing protein 1, mitochondrial

Gene

FASTKD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
  • protein kinase activity Source: InterPro

GO - Biological processi

  • cellular respiration Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
FAST kinase domain-containing protein 1, mitochondrial
Gene namesi
Name:FASTKD1
Synonyms:KIAA1800
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:26150. FASTKD1.

Subcellular locationi

GO - Cellular componenti

  • mitochondrion Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000138399.
PharmGKBiPA145148834.

Polymorphism and mutation databases

BioMutaiFASTKD1.
DMDMi74726532.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_0000284710? – 847FAST kinase domain-containing protein 1, mitochondrial
Transit peptidei1 – ?MitochondrionCurated

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei360N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ53R41.
MaxQBiQ53R41.
PaxDbiQ53R41.
PeptideAtlasiQ53R41.
PRIDEiQ53R41.

PTM databases

iPTMnetiQ53R41.
PhosphoSitePlusiQ53R41.

Expressioni

Tissue specificityi

Expression detected in spleen, thymus, testis, ovary, colon, heart, smooth muscle, kidney, brain, lung, liver and white adipose tissue with highest expression in heart.1 Publication

Gene expression databases

BgeeiENSG00000138399.
CleanExiHS_FASTKD1.
ExpressionAtlasiQ53R41. baseline and differential.
GenevisibleiQ53R41. HS.

Organism-specific databases

HPAiHPA043719.

Interactioni

Protein-protein interaction databases

BioGridi122800. 16 interactors.
IntActiQ53R41. 2 interactors.
MINTiMINT-8051772.
STRINGi9606.ENSP00000400513.

Structurei

3D structure databases

ProteinModelPortaliQ53R41.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini777 – 837RAPPROSITE-ProRule annotationAdd BLAST61

Sequence similaritiesi

Belongs to the FAST kinase family.Curated
Contains 1 RAP domain.PROSITE-ProRule annotation

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiENOG410IHTE. Eukaryota.
ENOG410Z496. LUCA.
GeneTreeiENSGT00530000063266.
HOGENOMiHOG000293293.
HOVERGENiHBG099520.
InParanoidiQ53R41.
OMAiAMGDMES.
OrthoDBiEOG091G0WV6.
PhylomeDBiQ53R41.
TreeFamiTF324885.

Family and domain databases

InterProiIPR013579. FAST_2.
IPR010622. FAST_Leu-rich.
IPR013584. RAP.
[Graphical view]
PfamiPF06743. FAST_1. 1 hit.
PF08368. FAST_2. 1 hit.
PF08373. RAP. 1 hit.
[Graphical view]
SMARTiSM00952. RAP. 1 hit.
[Graphical view]
PROSITEiPS51286. RAP. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q53R41-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKKTPVFLES LVTNMLRLRA ICPFSWRVFQ FRPISCEPLI IQMNKCTDEE
60 70 80 90 100
QMFGFIERNK AILSEKQVGC AFDMLWKLQK QKTSLLKNAE YVRDHPQFLT
110 120 130 140 150
LHNLATNKFK LMNDDTLVNV LYVTQQFAGE AHDPLVEALV TEAWRRLERF
160 170 180 190 200
DIKLLSEFSS CLADQHLYFS PLMGKIADIV HRNLETTQDL SSLSVLMVNI
210 220 230 240 250
SSLISRHFQQ QLVNKTELLF DTIDSSEVNV AKSIAKFLRN VRYRYQPLLE
260 270 280 290 300
RCNNVFLSNV DHLDLDSISK ILSVYKFLQF NSFEFIIMAK KKLTEMIPLC
310 320 330 340 350
NHPASFVKLF VALGPIAGPE EKKQLKSTML LMSEDLTGEQ ALAVLGAMGD
360 370 380 390 400
MESRNSCLIK RVTSVLHKHL DGYKPLELLK ITQELTFLHF QRKEFFAKLR
410 420 430 440 450
ELLLSYLKNS FIPTEVSVLV RAISLLPSPH LDEVGISRIE AVLPQCDLNN
460 470 480 490 500
LSSFATSVLR WIQHDHMYLD NMTAKQLKLL QKLDHYGRQR LQHSNSLDLL
510 520 530 540 550
RKELKSLKGN TFPESLLEEM IATLQHFMDD INYINVGEIA SFISSTDYLS
560 570 580 590 600
TLLLDRIASV AVQQIEKIHP FTIPAIIRPF SVLNYDPPQR DEFLGTCVQH
610 620 630 640 650
LNSYLGILDP FILVFLGFSL ATLEYFPEDL LKAIFNIKFL ARLDSQLEIL
660 670 680 690 700
SPSRSARVQF HLMELNRSVC LECPEFQIPW FHDRFCQQYN KGIGGMDGTQ
710 720 730 740 750
QQIFKMLAEV LGGINCVKAS VLTPYYHKVD FECILDKRKK PLPYGSHNIA
760 770 780 790 800
LGQLPEMPWE SNIEIVGSRL PPGAERIALE FLDSKALCRN IPHMKGKSAM
810 820 830 840
KKRHLEILGY RVIQISQFEW NSMALSTKDA RMDYLRECIF GEVKSCL
Length:847
Mass (Da):97,411
Last modified:May 24, 2005 - v1
Checksum:i5026A635048EB0B3
GO
Isoform 2 (identifier: Q53R41-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     649-692: ILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKG → S

Note: No experimental confirmation available.
Show »
Length:804
Mass (Da):92,204
Checksum:i1026298B7060A369
GO

Sequence cautioni

The sequence AAH32687 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB15168 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti213V → M in BAB85043 (PubMed:14702039).Curated1
Sequence conflicti228V → A in BAB85043 (PubMed:14702039).Curated1
Sequence conflicti288M → T in BAB15168 (PubMed:14702039).Curated1
Sequence conflicti293L → P in BAB85043 (PubMed:14702039).Curated1
Sequence conflicti756E → EMPWESNIEIVGSRLPPGAE RIALEFLDSKA in BAB47429 (PubMed:11347906).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_031806384E → Q.Corresponds to variant rs12618227dbSNPEnsembl.1
Natural variantiVAR_031807446C → G.Corresponds to variant rs35106223dbSNPEnsembl.1
Natural variantiVAR_031808467M → V.2 PublicationsCorresponds to variant rs2253680dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024617649 – 692ILSPS…QYNKG → S in isoform 2. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK025554 mRNA. Translation: BAB15168.1. Different initiation.
AK055892 mRNA. Translation: BAB71037.1.
AK074302 mRNA. Translation: BAB85043.1.
AC093899 Genomic DNA. Translation: AAY24118.1.
BC032687 mRNA. Translation: AAH32687.1. Different initiation.
AB058703 mRNA. Translation: BAB47429.1.
CCDSiCCDS33318.1. [Q53R41-1]
CCDS63051.1. [Q53R41-2]
RefSeqiNP_001268405.1. NM_001281476.2. [Q53R41-2]
NP_001308975.1. NM_001322046.1. [Q53R41-1]
NP_001308977.1. NM_001322048.1.
NP_001308978.1. NM_001322049.1.
NP_078898.3. NM_024622.5. [Q53R41-1]
XP_016860400.1. XM_017004911.1.
UniGeneiHs.529276.

Genome annotation databases

EnsembliENST00000453153; ENSP00000400513; ENSG00000138399. [Q53R41-1]
ENST00000453929; ENSP00000403229; ENSG00000138399. [Q53R41-2]
GeneIDi79675.
KEGGihsa:79675.
UCSCiuc002uev.6. human. [Q53R41-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK025554 mRNA. Translation: BAB15168.1. Different initiation.
AK055892 mRNA. Translation: BAB71037.1.
AK074302 mRNA. Translation: BAB85043.1.
AC093899 Genomic DNA. Translation: AAY24118.1.
BC032687 mRNA. Translation: AAH32687.1. Different initiation.
AB058703 mRNA. Translation: BAB47429.1.
CCDSiCCDS33318.1. [Q53R41-1]
CCDS63051.1. [Q53R41-2]
RefSeqiNP_001268405.1. NM_001281476.2. [Q53R41-2]
NP_001308975.1. NM_001322046.1. [Q53R41-1]
NP_001308977.1. NM_001322048.1.
NP_001308978.1. NM_001322049.1.
NP_078898.3. NM_024622.5. [Q53R41-1]
XP_016860400.1. XM_017004911.1.
UniGeneiHs.529276.

3D structure databases

ProteinModelPortaliQ53R41.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122800. 16 interactors.
IntActiQ53R41. 2 interactors.
MINTiMINT-8051772.
STRINGi9606.ENSP00000400513.

PTM databases

iPTMnetiQ53R41.
PhosphoSitePlusiQ53R41.

Polymorphism and mutation databases

BioMutaiFASTKD1.
DMDMi74726532.

Proteomic databases

EPDiQ53R41.
MaxQBiQ53R41.
PaxDbiQ53R41.
PeptideAtlasiQ53R41.
PRIDEiQ53R41.

Protocols and materials databases

DNASUi79675.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000453153; ENSP00000400513; ENSG00000138399. [Q53R41-1]
ENST00000453929; ENSP00000403229; ENSG00000138399. [Q53R41-2]
GeneIDi79675.
KEGGihsa:79675.
UCSCiuc002uev.6. human. [Q53R41-1]

Organism-specific databases

CTDi79675.
GeneCardsiFASTKD1.
H-InvDBHIX0002572.
HGNCiHGNC:26150. FASTKD1.
HPAiHPA043719.
neXtProtiNX_Q53R41.
OpenTargetsiENSG00000138399.
PharmGKBiPA145148834.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHTE. Eukaryota.
ENOG410Z496. LUCA.
GeneTreeiENSGT00530000063266.
HOGENOMiHOG000293293.
HOVERGENiHBG099520.
InParanoidiQ53R41.
OMAiAMGDMES.
OrthoDBiEOG091G0WV6.
PhylomeDBiQ53R41.
TreeFamiTF324885.

Miscellaneous databases

ChiTaRSiFASTKD1. human.
GenomeRNAii79675.
PROiQ53R41.

Gene expression databases

BgeeiENSG00000138399.
CleanExiHS_FASTKD1.
ExpressionAtlasiQ53R41. baseline and differential.
GenevisibleiQ53R41. HS.

Family and domain databases

InterProiIPR013579. FAST_2.
IPR010622. FAST_Leu-rich.
IPR013584. RAP.
[Graphical view]
PfamiPF06743. FAST_1. 1 hit.
PF08368. FAST_2. 1 hit.
PF08373. RAP. 1 hit.
[Graphical view]
SMARTiSM00952. RAP. 1 hit.
[Graphical view]
PROSITEiPS51286. RAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFAKD1_HUMAN
AccessioniPrimary (citable) accession number: Q53R41
Secondary accession number(s): Q8N583
, Q8TEA9, Q96JM5, Q96N71, Q9H6T4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: May 24, 2005
Last modified: November 2, 2016
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-15 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.