Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q53R41 (FAKD1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 69. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
FAST kinase domain-containing protein 1
Gene names
Name:FASTKD1
Synonyms:KIAA1800
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length847 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Sequence similarities

Belongs to the FAST kinase family.

Contains 1 RAP domain.

Caution

It is uncertain whether Met-1 or Met-15 is the initiator.

Sequence caution

The sequence AAH32687.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAB15168.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q53R41-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q53R41-2)

The sequence of this isoform differs from the canonical sequence as follows:
     649-692: ILSPSRSARVQFHLMELNRSVCLECPEFQIPWFHDRFCQQYNKG → S
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 847847FAST kinase domain-containing protein 1
PRO_0000284710

Regions

Domain777 – 83761RAP

Amino acid modifications

Modified residue3601N6-acetyllysine Ref.5

Natural variations

Alternative sequence649 – 69244ILSPS…QYNKG → S in isoform 2.
VSP_024617
Natural variant3841E → Q.
Corresponds to variant rs12618227 [ dbSNP | Ensembl ].
VAR_031806
Natural variant4461C → G.
Corresponds to variant rs35106223 [ dbSNP | Ensembl ].
VAR_031807
Natural variant4671M → V. Ref.1 Ref.3
Corresponds to variant rs2253680 [ dbSNP | Ensembl ].
VAR_031808

Experimental info

Sequence conflict2131V → M in BAB85043. Ref.1
Sequence conflict2281V → A in BAB85043. Ref.1
Sequence conflict2881M → T in BAB15168. Ref.1
Sequence conflict2931L → P in BAB85043. Ref.1
Sequence conflict7561E → EMPWESNIEIVGSRLPPGAE RIALEFLDSKA in BAB47429. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 24, 2005. Version 1.
Checksum: 5026A635048EB0B3

FASTA84797,411
        10         20         30         40         50         60 
MKKTPVFLES LVTNMLRLRA ICPFSWRVFQ FRPISCEPLI IQMNKCTDEE QMFGFIERNK 

        70         80         90        100        110        120 
AILSEKQVGC AFDMLWKLQK QKTSLLKNAE YVRDHPQFLT LHNLATNKFK LMNDDTLVNV 

       130        140        150        160        170        180 
LYVTQQFAGE AHDPLVEALV TEAWRRLERF DIKLLSEFSS CLADQHLYFS PLMGKIADIV 

       190        200        210        220        230        240 
HRNLETTQDL SSLSVLMVNI SSLISRHFQQ QLVNKTELLF DTIDSSEVNV AKSIAKFLRN 

       250        260        270        280        290        300 
VRYRYQPLLE RCNNVFLSNV DHLDLDSISK ILSVYKFLQF NSFEFIIMAK KKLTEMIPLC 

       310        320        330        340        350        360 
NHPASFVKLF VALGPIAGPE EKKQLKSTML LMSEDLTGEQ ALAVLGAMGD MESRNSCLIK 

       370        380        390        400        410        420 
RVTSVLHKHL DGYKPLELLK ITQELTFLHF QRKEFFAKLR ELLLSYLKNS FIPTEVSVLV 

       430        440        450        460        470        480 
RAISLLPSPH LDEVGISRIE AVLPQCDLNN LSSFATSVLR WIQHDHMYLD NMTAKQLKLL 

       490        500        510        520        530        540 
QKLDHYGRQR LQHSNSLDLL RKELKSLKGN TFPESLLEEM IATLQHFMDD INYINVGEIA 

       550        560        570        580        590        600 
SFISSTDYLS TLLLDRIASV AVQQIEKIHP FTIPAIIRPF SVLNYDPPQR DEFLGTCVQH 

       610        620        630        640        650        660 
LNSYLGILDP FILVFLGFSL ATLEYFPEDL LKAIFNIKFL ARLDSQLEIL SPSRSARVQF 

       670        680        690        700        710        720 
HLMELNRSVC LECPEFQIPW FHDRFCQQYN KGIGGMDGTQ QQIFKMLAEV LGGINCVKAS 

       730        740        750        760        770        780 
VLTPYYHKVD FECILDKRKK PLPYGSHNIA LGQLPEMPWE SNIEIVGSRL PPGAERIALE 

       790        800        810        820        830        840 
FLDSKALCRN IPHMKGKSAM KKRHLEILGY RVIQISQFEW NSMALSTKDA RMDYLRECIF 


GEVKSCL 

« Hide

Isoform 2 [UniParc].

Checksum: 1026298B7060A369
Show »

FASTA80492,204

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 166-847 (ISOFORM 1), VARIANT VAL-467.
Tissue: Mammary gland.
[2]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 93-847 (ISOFORM 1), VARIANT VAL-467.
Tissue: Eye.
[4]"Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 142-847 (ISOFORM 1).
Tissue: Brain.
[5]"Lysine acetylation targets protein complexes and co-regulates major cellular functions."
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-360, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK025554 mRNA. Translation: BAB15168.1. Different initiation.
AK055892 mRNA. Translation: BAB71037.1.
AK074302 mRNA. Translation: BAB85043.1.
AC093899 Genomic DNA. Translation: AAY24118.1.
BC032687 mRNA. Translation: AAH32687.1. Different initiation.
AB058703 mRNA. Translation: BAB47429.1.
RefSeqNP_001268405.1. NM_001281476.1.
NP_078898.3. NM_024622.4.
UniGeneHs.529276.

3D structure databases

ProteinModelPortalQ53R41.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122800. 1 interaction.
IntActQ53R41. 2 interactions.
MINTMINT-8051772.
STRING9606.ENSP00000400513.

PTM databases

PhosphoSiteQ53R41.

Polymorphism databases

DMDM74726532.

Proteomic databases

PaxDbQ53R41.
PRIDEQ53R41.

Protocols and materials databases

DNASU79675.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000453153; ENSP00000400513; ENSG00000138399. [Q53R41-1]
ENST00000453929; ENSP00000403229; ENSG00000138399. [Q53R41-2]
GeneID79675.
KEGGhsa:79675.
UCSCuc002uev.4. human. [Q53R41-1]
uc002uex.5. human. [Q53R41-2]

Organism-specific databases

CTD79675.
GeneCardsGC02M170386.
H-InvDBHIX0002572.
HGNCHGNC:26150. FASTKD1.
HPAHPA043719.
neXtProtNX_Q53R41.
PharmGKBPA145148834.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG39093.
HOGENOMHOG000293293.
HOVERGENHBG099520.
InParanoidQ53R41.
OMAGYRVIQI.
OrthoDBEOG7TBC2C.
PhylomeDBQ53R41.
TreeFamTF324885.

Gene expression databases

ArrayExpressQ53R41.
BgeeQ53R41.
CleanExHS_FASTKD1.
GenevestigatorQ53R41.

Family and domain databases

InterProIPR013579. FAST_2.
IPR010622. FAST_Leu-rich.
IPR013584. RAP.
[Graphical view]
PfamPF06743. FAST_1. 1 hit.
PF08368. FAST_2. 1 hit.
PF08373. RAP. 1 hit.
[Graphical view]
SMARTSM00952. RAP. 1 hit.
[Graphical view]
PROSITEPS51286. RAP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi79675.
NextBio68914.
PROQ53R41.

Entry information

Entry nameFAKD1_HUMAN
AccessionPrimary (citable) accession number: Q53R41
Secondary accession number(s): Q8N583 expand/collapse secondary AC list , Q8TEA9, Q96JM5, Q96N71, Q9H6T4
Entry history
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: May 24, 2005
Last modified: April 16, 2014
This is version 69 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM