Q53GS9 (SNUT2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: U4/U6.U5 tri-snRNP-associated protein 2 Alternative name(s): Inactive ubiquitin-specific peptidase 39 SAD1 homolog U4/U6.U5 tri-snRNP-associated 65 kDa protein Short name=65K | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 565 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in pre-mRNA splicing as a component of the U4/U6-U5 tri-snRNP, one of the building blocks of the spliceosome. Regulates AURKB mRNA levels, and thereby plays a role in cytokinesis and in the spindle checkpoint. Does not have ubiquitin-specific peptidase activity, but could be a competitor of ubiquitin C-terminal hydrolases (UCHs). Ref.1 Ref.12 |
| Subunit structure | Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, WDR57, SNRNP40, DDX23, CD2BP2, PPIH, NHP2L1, EFTUD2, SART1 and USP39. Ref.11 |
| Subcellular location | |
| Sequence similarities | Belongs to the peptidase C19 family. Contains 1 UBP-type zinc finger. |
| Sequence caution | The sequence AAD27730.1 differs from that shown. Reason: Frameshift at several positions. The sequence AAG35521.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell cycle Cell division mRNA processing mRNA splicing |
| Cellular component | Nucleus Spliceosome |
| Coding sequence diversity | Alternative splicing |
| Domain | Zinc-finger |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell cycle Inferred from electronic annotation. Source: UniProtKB-KW cell divisionInferred from electronic annotation. Source: UniProtKB-KW spliceosomal complex assemblyTraceable author statement PubMed 10022888. Source: ProtInc ubiquitin-dependent protein catabolic processInferred from electronic annotation. Source: InterPro |
| Cellular_component | spliceosomal complex Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | ubiquitin thiolesterase activity Inferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q53GS9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q53GS9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-89: MSGRSKRESR...EDSEPEREVR → MLTAVPSHLFS 113-144: RSVLDFDFEKLCSISLSHINAYACLVCGKYFQ → SFSPFPT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 565 | 565 | U4/U6.U5 tri-snRNP-associated protein 2 | PRO_0000223962 | |||||
Regions | |||||||||
| Zinc finger | 122 – 183 | 62 | UBP-type | ||||||
| Compositional bias | 4 – 103 | 100 | Arg-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 82 | 1 | Phosphoserine Ref.10 Ref.14 Ref.16 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 89 | 89 | MSGRS…EREVR → MLTAVPSHLFS in isoform 2. | VSP_045167 | |||||
| Alternative sequence | 113 – 144 | 32 | RSVLD…GKYFQ → SFSPFPT in isoform 2. | VSP_045168 | |||||
Experimental info | |||||||||
| Sequence conflict | 13 | 1 | T → I in BAD96572. Ref.4 | ||||||
| Sequence conflict | 135 | 1 | A → V in BAD96572. Ref.4 | ||||||
| Sequence conflict | 400 | 1 | L → F in AAK49524. Ref.1 | ||||||
| Sequence conflict | 456 | 1 | R → I in AAD27730. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The 65 and 110 kDa SR-related proteins of the U4/U6*U5 tri-snRNP are essential for the assembly of mature spliceosomes." Makarova O.V., Makarov E.M., Luehrmann R. EMBO J. 20:2553-2563(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION. |
| [2] | "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics." Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C. Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Caudate nucleus. |
| [4] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Liver. |
| [5] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skin and Uterus. |
| [8] | "Functional prediction of the coding sequences of 75 new genes deduced by analysis of cDNA clones from human fetal liver." Zhang C., Yu Y., Zhang S., Wei H., Bi J., Zhou G., Dong C., Zai Y., Xu W., Gao F., Liu M., He F. Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 104-565. Tissue: Fetal liver. |
| [9] | "Human partial CDS from CD34+ stem cells." Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z. Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 305-565. Tissue: Umbilical cord blood. |
| [10] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "The network of protein-protein interactions within the human U4/U6.U5 tri-snRNP." Liu S., Rauhut R., Vornlocher H.-P., Luehrmann R. RNA 12:1418-1430(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT. |
| [12] | "Usp39 is essential for mitotic spindle checkpoint integrity and controls mRNA-levels of aurora B." van Leuken R.J., Luna-Vargas M.P., Sixma T.K., Wolthuis R.M., Medema R.H. Cell Cycle 7:2710-2719(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, ABSENCE OF UBIQUITIN-SPECIFIC PEPTIDASE ACTIVITY. |
| [13] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [14] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [16] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF353989 mRNA. Translation: AAK49524.1. AF132955 mRNA. Translation: AAD27730.1. Frameshift. AK289451 mRNA. Translation: BAF82140.1. AK295257 mRNA. Translation: BAG58246.1. AK222852 mRNA. Translation: BAD96572.1. AC012454 Genomic DNA. No translation available. AC016753 Genomic DNA. No translation available. CH471053 Genomic DNA. Translation: EAW99490.1. CH471053 Genomic DNA. Translation: EAW99492.1. CH471053 Genomic DNA. Translation: EAW99493.1. BC001384 mRNA. Translation: AAH01384.2. BC067273 mRNA. Translation: AAH67273.1. AF130096 mRNA. Translation: AAG35521.1. Different initiation. AF161450 mRNA. Translation: AAF29010.1. |
| IPI | IPI00419844. |
| RefSeq | NP_001243654.1. NM_001256725.1. NP_001243656.1. NM_001256727.1. NP_001243657.1. NM_001256728.1. NP_006581.2. NM_006590.3. |
| UniGene | Hs.654745. |
3D structure databases | |
| ProteinModelPortal | Q53GS9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q53GS9. 33 interactions. |
| STRING | 9606.ENSP00000312981. |
Protein family/group databases | |
| MEROPS | C19.972. |
PTM databases | |
| PhosphoSite | Q53GS9. |
Polymorphism databases | |
| DMDM | 88909655. |
Proteomic databases | |
| PaxDb | Q53GS9. |
| PeptideAtlas | Q53GS9. |
| PRIDE | Q53GS9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000323701; ENSP00000312981; ENSG00000168883. ENST00000409470; ENSP00000386864; ENSG00000168883. ENST00000450066; ENSP00000396133; ENSG00000168883. |
| GeneID | 10713. |
| KEGG | hsa:10713. |
| UCSC | uc002sqb.3. human. |
Organism-specific databases | |
| CTD | 10713. |
| GeneCards | GC02P085829. |
| HGNC | HGNC:20071. USP39. |
| HPA | HPA034823. |
| MIM | 611594. gene. |
| neXtProt | NX_Q53GS9. |
| PharmGKB | PA134905136. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG259163. |
| HOVERGEN | HBG079718. |
| InParanoid | Q53GS9. |
| KO | K12847. |
| OMA | SHINVYA. |
| OrthoDB | EOG4C5CJ7. |
| PhylomeDB | Q53GS9. |
Gene expression databases | |
| ArrayExpress | Q53GS9. |
| Bgee | Q53GS9. |
| CleanEx | HS_USP39. |
| Genevestigator | Q53GS9. |
| GermOnline | ENSG00000168883. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.40.10. 1 hit. |
| InterPro | IPR001394. Peptidase_C19. IPR015880. Znf_C2H2-like. IPR013083. Znf_RING/FYVE/PHD. IPR001607. Znf_UBP. [Graphical view] |
| Pfam | PF00443. UCH. 1 hit. PF02148. zf-UBP. 1 hit. [Graphical view] |
| SMART | SM00355. ZnF_C2H2. 1 hit. [Graphical view] |
| PROSITE | PS00972. UCH_2_1. False negative. PS00973. UCH_2_2. False negative. PS50235. UCH_2_3. 1 hit. PS50271. ZF_UBP. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 10713. |
| NextBio | 40671. |
| SOURCE | Search... |
Entry information
| Entry name | SNUT2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q53GS9 Secondary accession number(s): A8K086 Q9Y310 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
