Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q53GS9

- SNUT2_HUMAN

UniProt

Q53GS9 - SNUT2_HUMAN

Protein

U4/U6.U5 tri-snRNP-associated protein 2

Gene

USP39

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 97 (01 Oct 2014)
      Sequence version 2 (21 Feb 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in pre-mRNA splicing as a component of the U4/U6-U5 tri-snRNP, one of the building blocks of the spliceosome. Regulates AURKB mRNA levels, and thereby plays a role in cytokinesis and in the spindle checkpoint. Does not have ubiquitin-specific peptidase activity, but could be a competitor of ubiquitin C-terminal hydrolases (UCHs).2 Publications

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri122 – 18362UBP-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. ubiquitinyl hydrolase activity Source: InterPro
    2. zinc ion binding Source: InterPro

    GO - Biological processi

    1. cell cycle Source: UniProtKB-KW
    2. cell division Source: UniProtKB-KW
    3. mRNA processing Source: ProtInc
    4. RNA splicing Source: ProtInc
    5. spliceosomal complex assembly Source: ProtInc
    6. ubiquitin-dependent protein catabolic process Source: InterPro

    Keywords - Biological processi

    Cell cycle, Cell division, mRNA processing, mRNA splicing

    Keywords - Ligandi

    Metal-binding, Zinc

    Protein family/group databases

    MEROPSiC19.972.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    U4/U6.U5 tri-snRNP-associated protein 2
    Alternative name(s):
    Inactive ubiquitin-specific peptidase 39
    SAD1 homolog
    U4/U6.U5 tri-snRNP-associated 65 kDa protein
    Short name:
    65K
    Gene namesi
    Name:USP39
    ORF Names:CGI-21, HSPC332, PRO2855
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:20071. USP39.

    Subcellular locationi

    Nucleus 1 Publication

    GO - Cellular componenti

    1. spliceosomal complex Source: UniProtKB-KW

    Keywords - Cellular componenti

    Nucleus, Spliceosome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134905136.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 565565U4/U6.U5 tri-snRNP-associated protein 2PRO_0000223962Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei82 – 821Phosphoserine3 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ53GS9.
    PaxDbiQ53GS9.
    PeptideAtlasiQ53GS9.
    PRIDEiQ53GS9.

    PTM databases

    PhosphoSiteiQ53GS9.

    Expressioni

    Gene expression databases

    ArrayExpressiQ53GS9.
    BgeeiQ53GS9.
    CleanExiHS_USP39.
    GenevestigatoriQ53GS9.

    Organism-specific databases

    HPAiHPA034823.

    Interactioni

    Subunit structurei

    Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, WDR57, SNRNP40, DDX23, CD2BP2, PPIH, NHP2L1, EFTUD2, SART1 and USP39.1 Publication

    Protein-protein interaction databases

    BioGridi115939. 77 interactions.
    IntActiQ53GS9. 38 interactions.
    MINTiMINT-4655337.
    STRINGi9606.ENSP00000312981.

    Structurei

    3D structure databases

    ProteinModelPortaliQ53GS9.
    SMRiQ53GS9. Positions 134-556.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini225 – 555331USPAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi4 – 103100Arg-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the peptidase C19 family.Curated
    Contains 1 UBP-type zinc finger.PROSITE-ProRule annotation
    Contains 1 USP domain.Curated

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri122 – 18362UBP-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Zinc-finger

    Phylogenomic databases

    eggNOGiNOG259163.
    HOVERGENiHBG079718.
    InParanoidiQ53GS9.
    KOiK12847.
    OMAiAYTHSVQ.
    OrthoDBiEOG7KH9JG.
    PhylomeDBiQ53GS9.
    TreeFamiTF300610.

    Family and domain databases

    Gene3Di3.30.40.10. 1 hit.
    InterProiIPR001394. Peptidase_C19_UCH.
    IPR028889. UCH/PAN2.
    IPR015880. Znf_C2H2-like.
    IPR013083. Znf_RING/FYVE/PHD.
    IPR001607. Znf_UBP.
    [Graphical view]
    PfamiPF00443. UCH. 1 hit.
    PF02148. zf-UBP. 1 hit.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 1 hit.
    [Graphical view]
    PROSITEiPS50235. USP_3. 1 hit.
    PS50271. ZF_UBP. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q53GS9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSGRSKRESR GSTRGKRESE SRGSSGRVKR ERDREREPEA ASSRGSPVRV    50
    KREFEPASAR EAPASVVPFV RVKREREVDE DSEPEREVRA KNGRVDSEDR 100
    RSRHCPYLDT INRSVLDFDF EKLCSISLSH INAYACLVCG KYFQGRGLKS 150
    HAYIHSVQFS HHVFLNLHTL KFYCLPDNYE IIDSSLEDIT YVLKPTFTKQ 200
    QIANLDKQAK LSRAYDGTTY LPGIVGLNNI KANDYANAVL QALSNVPPLR 250
    NYFLEEDNYK NIKRPPGDIM FLLVQRFGEL MRKLWNPRNF KAHVSPHEML 300
    QAVVLCSKKT FQITKQGDGV DFLSWFLNAL HSALGGTKKK KKTIVTDVFQ 350
    GSMRIFTKKL PHPDLPAEEK EQLLHNDEYQ ETMVESTFMY LTLDLPTAPL 400
    YKDEKEQLII PQVPLFNILA KFNGITEKEY KTYKENFLKR FQLTKLPPYL 450
    IFCIKRFTKN NFFVEKNPTI VNFPITNVDL REYLSEEVQA VHKNTTYDLI 500
    ANIVHDGKPS EGSYRIHVLH HGTGKWYELQ DLQVTDILPQ MITLSEAYIQ 550
    IWKRRDNDET NQQGA 565
    Length:565
    Mass (Da):65,381
    Last modified:February 21, 2006 - v2
    Checksum:i8946FD5DCDEFD0B0
    GO
    Isoform 2 (identifier: Q53GS9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-89: MSGRSKRESR...EDSEPEREVR → MLTAVPSHLFS
         113-144: RSVLDFDFEKLCSISLSHINAYACLVCGKYFQ → SFSPFPT

    Show »
    Length:462
    Mass (Da):53,510
    Checksum:iC57BF48DC1B0F9D5
    GO
    Isoform 3 (identifier: Q53GS9-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         477-565: NVDLREYLSE...DNDETNQQGA → GQANGMNYKTSR

    Show »
    Length:488
    Mass (Da):56,359
    Checksum:i757387284D021074
    GO

    Sequence cautioni

    The sequence AAD27730.1 differs from that shown. Reason: Frameshift at several positions.
    The sequence AAG35521.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti13 – 131T → I in BAD96572. 1 PublicationCurated
    Sequence conflicti135 – 1351A → V in BAD96572. 1 PublicationCurated
    Sequence conflicti277 – 2771F → S in BAG50852. (PubMed:14702039)Curated
    Sequence conflicti280 – 2801L → P in BAG50852. (PubMed:14702039)Curated
    Sequence conflicti294 – 2941V → A in BAG50852. (PubMed:14702039)Curated
    Sequence conflicti400 – 4001L → F in AAK49524. (PubMed:11350945)Curated
    Sequence conflicti456 – 4561R → I in AAD27730. (PubMed:10810093)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 8989MSGRS…EREVR → MLTAVPSHLFS in isoform 2. 1 PublicationVSP_045167Add
    BLAST
    Alternative sequencei113 – 14432RSVLD…GKYFQ → SFSPFPT in isoform 2. 1 PublicationVSP_045168Add
    BLAST
    Alternative sequencei477 – 56589NVDLR…NQQGA → GQANGMNYKTSR in isoform 3. 1 PublicationVSP_046822Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF353989 mRNA. Translation: AAK49524.1.
    AF132955 mRNA. Translation: AAD27730.1. Frameshift.
    AK289451 mRNA. Translation: BAF82140.1.
    AK001047 mRNA. Translation: BAG50852.1.
    AK295257 mRNA. Translation: BAG58246.1.
    AK222852 mRNA. Translation: BAD96572.1.
    AC012454 Genomic DNA. No translation available.
    AC016753 Genomic DNA. No translation available.
    CH471053 Genomic DNA. Translation: EAW99490.1.
    CH471053 Genomic DNA. Translation: EAW99492.1.
    CH471053 Genomic DNA. Translation: EAW99493.1.
    CH471053 Genomic DNA. Translation: EAW99494.1.
    BC001384 mRNA. Translation: AAH01384.2.
    BC067273 mRNA. Translation: AAH67273.1.
    AF130096 mRNA. Translation: AAG35521.1. Different initiation.
    AF161450 mRNA. Translation: AAF29010.1.
    CCDSiCCDS33234.1. [Q53GS9-1]
    CCDS58716.1. [Q53GS9-2]
    CCDS58717.1. [Q53GS9-3]
    RefSeqiNP_001243654.1. NM_001256725.1. [Q53GS9-1]
    NP_001243655.1. NM_001256726.1. [Q53GS9-3]
    NP_001243656.1. NM_001256727.1.
    NP_001243657.1. NM_001256728.1. [Q53GS9-2]
    NP_006581.2. NM_006590.3. [Q53GS9-1]
    XP_006711985.1. XM_006711922.1.
    XP_006711986.1. XM_006711923.1.
    UniGeneiHs.654745.

    Genome annotation databases

    EnsembliENST00000323701; ENSP00000312981; ENSG00000168883. [Q53GS9-1]
    ENST00000409470; ENSP00000386864; ENSG00000168883. [Q53GS9-1]
    ENST00000409766; ENSP00000386803; ENSG00000168883. [Q53GS9-3]
    ENST00000450066; ENSP00000396133; ENSG00000168883. [Q53GS9-2]
    GeneIDi10713.
    KEGGihsa:10713.
    UCSCiuc002sqb.4. human. [Q53GS9-1]
    uc010fgo.4. human.
    uc010ysv.3. human.

    Polymorphism databases

    DMDMi88909655.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF353989 mRNA. Translation: AAK49524.1 .
    AF132955 mRNA. Translation: AAD27730.1 . Frameshift.
    AK289451 mRNA. Translation: BAF82140.1 .
    AK001047 mRNA. Translation: BAG50852.1 .
    AK295257 mRNA. Translation: BAG58246.1 .
    AK222852 mRNA. Translation: BAD96572.1 .
    AC012454 Genomic DNA. No translation available.
    AC016753 Genomic DNA. No translation available.
    CH471053 Genomic DNA. Translation: EAW99490.1 .
    CH471053 Genomic DNA. Translation: EAW99492.1 .
    CH471053 Genomic DNA. Translation: EAW99493.1 .
    CH471053 Genomic DNA. Translation: EAW99494.1 .
    BC001384 mRNA. Translation: AAH01384.2 .
    BC067273 mRNA. Translation: AAH67273.1 .
    AF130096 mRNA. Translation: AAG35521.1 . Different initiation.
    AF161450 mRNA. Translation: AAF29010.1 .
    CCDSi CCDS33234.1. [Q53GS9-1 ]
    CCDS58716.1. [Q53GS9-2 ]
    CCDS58717.1. [Q53GS9-3 ]
    RefSeqi NP_001243654.1. NM_001256725.1. [Q53GS9-1 ]
    NP_001243655.1. NM_001256726.1. [Q53GS9-3 ]
    NP_001243656.1. NM_001256727.1.
    NP_001243657.1. NM_001256728.1. [Q53GS9-2 ]
    NP_006581.2. NM_006590.3. [Q53GS9-1 ]
    XP_006711985.1. XM_006711922.1.
    XP_006711986.1. XM_006711923.1.
    UniGenei Hs.654745.

    3D structure databases

    ProteinModelPortali Q53GS9.
    SMRi Q53GS9. Positions 134-556.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115939. 77 interactions.
    IntActi Q53GS9. 38 interactions.
    MINTi MINT-4655337.
    STRINGi 9606.ENSP00000312981.

    Protein family/group databases

    MEROPSi C19.972.

    PTM databases

    PhosphoSitei Q53GS9.

    Polymorphism databases

    DMDMi 88909655.

    Proteomic databases

    MaxQBi Q53GS9.
    PaxDbi Q53GS9.
    PeptideAtlasi Q53GS9.
    PRIDEi Q53GS9.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000323701 ; ENSP00000312981 ; ENSG00000168883 . [Q53GS9-1 ]
    ENST00000409470 ; ENSP00000386864 ; ENSG00000168883 . [Q53GS9-1 ]
    ENST00000409766 ; ENSP00000386803 ; ENSG00000168883 . [Q53GS9-3 ]
    ENST00000450066 ; ENSP00000396133 ; ENSG00000168883 . [Q53GS9-2 ]
    GeneIDi 10713.
    KEGGi hsa:10713.
    UCSCi uc002sqb.4. human. [Q53GS9-1 ]
    uc010fgo.4. human.
    uc010ysv.3. human.

    Organism-specific databases

    CTDi 10713.
    GeneCardsi GC02P085829.
    HGNCi HGNC:20071. USP39.
    HPAi HPA034823.
    MIMi 611594. gene.
    neXtProti NX_Q53GS9.
    PharmGKBi PA134905136.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG259163.
    HOVERGENi HBG079718.
    InParanoidi Q53GS9.
    KOi K12847.
    OMAi AYTHSVQ.
    OrthoDBi EOG7KH9JG.
    PhylomeDBi Q53GS9.
    TreeFami TF300610.

    Miscellaneous databases

    GeneWikii USP39.
    GenomeRNAii 10713.
    NextBioi 40671.
    PROi Q53GS9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q53GS9.
    Bgeei Q53GS9.
    CleanExi HS_USP39.
    Genevestigatori Q53GS9.

    Family and domain databases

    Gene3Di 3.30.40.10. 1 hit.
    InterProi IPR001394. Peptidase_C19_UCH.
    IPR028889. UCH/PAN2.
    IPR015880. Znf_C2H2-like.
    IPR013083. Znf_RING/FYVE/PHD.
    IPR001607. Znf_UBP.
    [Graphical view ]
    Pfami PF00443. UCH. 1 hit.
    PF02148. zf-UBP. 1 hit.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 1 hit.
    [Graphical view ]
    PROSITEi PS50235. USP_3. 1 hit.
    PS50271. ZF_UBP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The 65 and 110 kDa SR-related proteins of the U4/U6*U5 tri-snRNP are essential for the assembly of mature spliceosomes."
      Makarova O.V., Makarov E.M., Luehrmann R.
      EMBO J. 20:2553-2563(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION.
    2. "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
      Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
      Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
      Tissue: Caudate nucleus and Embryo.
    4. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Liver.
    5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Skin and Uterus.
    8. "Functional prediction of the coding sequences of 75 new genes deduced by analysis of cDNA clones from human fetal liver."
      Zhang C., Yu Y., Zhang S., Wei H., Bi J., Zhou G., Dong C., Zai Y., Xu W., Gao F., Liu M., He F.
      Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 104-565.
      Tissue: Fetal liver.
    9. "Human partial CDS from CD34+ stem cells."
      Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z.
      Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 305-565.
      Tissue: Umbilical cord blood.
    10. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. "The network of protein-protein interactions within the human U4/U6.U5 tri-snRNP."
      Liu S., Rauhut R., Vornlocher H.-P., Luehrmann R.
      RNA 12:1418-1430(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBUNIT.
    12. "Usp39 is essential for mitotic spindle checkpoint integrity and controls mRNA-levels of aurora B."
      van Leuken R.J., Luna-Vargas M.P., Sixma T.K., Wolthuis R.M., Medema R.H.
      Cell Cycle 7:2710-2719(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, ABSENCE OF UBIQUITIN-SPECIFIC PEPTIDASE ACTIVITY.
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiSNUT2_HUMAN
    AccessioniPrimary (citable) accession number: Q53GS9
    Secondary accession number(s): A8K086
    , B3KM40, B4DHT4, D6W5L4, G5E9H0, Q6NX47, Q96RK9, Q9BV89, Q9H381, Q9P050, Q9Y310
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 21, 2006
    Last sequence update: February 21, 2006
    Last modified: October 1, 2014
    This is version 97 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. Peptidase families
      Classification of peptidase families and list of entries
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3