Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q53GS9

- SNUT2_HUMAN

UniProt

Q53GS9 - SNUT2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

U4/U6.U5 tri-snRNP-associated protein 2

Gene

USP39

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Plays a role in pre-mRNA splicing as a component of the U4/U6-U5 tri-snRNP, one of the building blocks of the spliceosome. Regulates AURKB mRNA levels, and thereby plays a role in cytokinesis and in the spindle checkpoint. Does not have ubiquitin-specific peptidase activity, but could be a competitor of ubiquitin C-terminal hydrolases (UCHs).2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri122 – 18362UBP-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. ubiquitinyl hydrolase activity Source: InterPro
  2. zinc ion binding Source: InterPro

GO - Biological processi

  1. cell cycle Source: UniProtKB-KW
  2. cell division Source: UniProtKB-KW
  3. mRNA processing Source: ProtInc
  4. RNA splicing Source: ProtInc
  5. spliceosomal complex assembly Source: ProtInc
  6. ubiquitin-dependent protein catabolic process Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, mRNA processing, mRNA splicing

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiC19.972.

Names & Taxonomyi

Protein namesi
Recommended name:
U4/U6.U5 tri-snRNP-associated protein 2
Alternative name(s):
Inactive ubiquitin-specific peptidase 39
SAD1 homolog
U4/U6.U5 tri-snRNP-associated 65 kDa protein
Short name:
65K
Gene namesi
Name:USP39
ORF Names:CGI-21, HSPC332, PRO2855
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:20071. USP39.

Subcellular locationi

Nucleus 1 Publication

GO - Cellular componenti

  1. spliceosomal complex Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus, Spliceosome

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134905136.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 565565U4/U6.U5 tri-snRNP-associated protein 2PRO_0000223962Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei82 – 821Phosphoserine3 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ53GS9.
PaxDbiQ53GS9.
PeptideAtlasiQ53GS9.
PRIDEiQ53GS9.

PTM databases

PhosphoSiteiQ53GS9.

Expressioni

Gene expression databases

BgeeiQ53GS9.
CleanExiHS_USP39.
ExpressionAtlasiQ53GS9. baseline and differential.
GenevestigatoriQ53GS9.

Organism-specific databases

HPAiHPA034823.

Interactioni

Subunit structurei

Component of the U4/U6-U5 tri-snRNP complex composed of the U4, U6 and U5 snRNAs and at least PRPF3, PRPF4, PRPF6, PRPF8, PRPF31, SNRNP200, TXNL4A, WDR57, SNRNP40, DDX23, CD2BP2, PPIH, NHP2L1, EFTUD2, SART1 and USP39.1 Publication

Protein-protein interaction databases

BioGridi115939. 79 interactions.
IntActiQ53GS9. 38 interactions.
MINTiMINT-4655337.
STRINGi9606.ENSP00000312981.

Structurei

3D structure databases

ProteinModelPortaliQ53GS9.
SMRiQ53GS9. Positions 107-556.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini225 – 555331USPAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi4 – 103100Arg-richAdd
BLAST

Sequence similaritiesi

Belongs to the peptidase C19 family.Curated
Contains 1 UBP-type zinc finger.PROSITE-ProRule annotation
Contains 1 USP domain.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri122 – 18362UBP-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiNOG259163.
GeneTreeiENSGT00390000007992.
HOVERGENiHBG079718.
InParanoidiQ53GS9.
KOiK12847.
OMAiAYTHSVQ.
OrthoDBiEOG7KH9JG.
PhylomeDBiQ53GS9.
TreeFamiTF300610.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR001394. Peptidase_C19_UCH.
IPR028889. UCH/PAN2.
IPR015880. Znf_C2H2-like.
IPR013083. Znf_RING/FYVE/PHD.
IPR001607. Znf_UBP.
[Graphical view]
PfamiPF00443. UCH. 1 hit.
PF02148. zf-UBP. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 1 hit.
[Graphical view]
PROSITEiPS50235. USP_3. 1 hit.
PS50271. ZF_UBP. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q53GS9) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGRSKRESR GSTRGKRESE SRGSSGRVKR ERDREREPEA ASSRGSPVRV
60 70 80 90 100
KREFEPASAR EAPASVVPFV RVKREREVDE DSEPEREVRA KNGRVDSEDR
110 120 130 140 150
RSRHCPYLDT INRSVLDFDF EKLCSISLSH INAYACLVCG KYFQGRGLKS
160 170 180 190 200
HAYIHSVQFS HHVFLNLHTL KFYCLPDNYE IIDSSLEDIT YVLKPTFTKQ
210 220 230 240 250
QIANLDKQAK LSRAYDGTTY LPGIVGLNNI KANDYANAVL QALSNVPPLR
260 270 280 290 300
NYFLEEDNYK NIKRPPGDIM FLLVQRFGEL MRKLWNPRNF KAHVSPHEML
310 320 330 340 350
QAVVLCSKKT FQITKQGDGV DFLSWFLNAL HSALGGTKKK KKTIVTDVFQ
360 370 380 390 400
GSMRIFTKKL PHPDLPAEEK EQLLHNDEYQ ETMVESTFMY LTLDLPTAPL
410 420 430 440 450
YKDEKEQLII PQVPLFNILA KFNGITEKEY KTYKENFLKR FQLTKLPPYL
460 470 480 490 500
IFCIKRFTKN NFFVEKNPTI VNFPITNVDL REYLSEEVQA VHKNTTYDLI
510 520 530 540 550
ANIVHDGKPS EGSYRIHVLH HGTGKWYELQ DLQVTDILPQ MITLSEAYIQ
560
IWKRRDNDET NQQGA
Length:565
Mass (Da):65,381
Last modified:February 21, 2006 - v2
Checksum:i8946FD5DCDEFD0B0
GO
Isoform 2 (identifier: Q53GS9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-89: MSGRSKRESR...EDSEPEREVR → MLTAVPSHLFS
     113-144: RSVLDFDFEKLCSISLSHINAYACLVCGKYFQ → SFSPFPT

Show »
Length:462
Mass (Da):53,510
Checksum:iC57BF48DC1B0F9D5
GO
Isoform 3 (identifier: Q53GS9-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     477-565: NVDLREYLSE...DNDETNQQGA → GQANGMNYKTSR

Show »
Length:488
Mass (Da):56,359
Checksum:i757387284D021074
GO

Sequence cautioni

The sequence AAD27730.1 differs from that shown. Reason: Frameshift at several positions.
The sequence AAG35521.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti13 – 131T → I in BAD96572. 1 PublicationCurated
Sequence conflicti135 – 1351A → V in BAD96572. 1 PublicationCurated
Sequence conflicti277 – 2771F → S in BAG50852. (PubMed:14702039)Curated
Sequence conflicti280 – 2801L → P in BAG50852. (PubMed:14702039)Curated
Sequence conflicti294 – 2941V → A in BAG50852. (PubMed:14702039)Curated
Sequence conflicti400 – 4001L → F in AAK49524. (PubMed:11350945)Curated
Sequence conflicti456 – 4561R → I in AAD27730. (PubMed:10810093)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 8989MSGRS…EREVR → MLTAVPSHLFS in isoform 2. 1 PublicationVSP_045167Add
BLAST
Alternative sequencei113 – 14432RSVLD…GKYFQ → SFSPFPT in isoform 2. 1 PublicationVSP_045168Add
BLAST
Alternative sequencei477 – 56589NVDLR…NQQGA → GQANGMNYKTSR in isoform 3. 1 PublicationVSP_046822Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF353989 mRNA. Translation: AAK49524.1.
AF132955 mRNA. Translation: AAD27730.1. Frameshift.
AK289451 mRNA. Translation: BAF82140.1.
AK001047 mRNA. Translation: BAG50852.1.
AK295257 mRNA. Translation: BAG58246.1.
AK222852 mRNA. Translation: BAD96572.1.
AC012454 Genomic DNA. No translation available.
AC016753 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAW99490.1.
CH471053 Genomic DNA. Translation: EAW99492.1.
CH471053 Genomic DNA. Translation: EAW99493.1.
CH471053 Genomic DNA. Translation: EAW99494.1.
BC001384 mRNA. Translation: AAH01384.2.
BC067273 mRNA. Translation: AAH67273.1.
AF130096 mRNA. Translation: AAG35521.1. Different initiation.
AF161450 mRNA. Translation: AAF29010.1.
CCDSiCCDS33234.1. [Q53GS9-1]
CCDS58716.1. [Q53GS9-2]
CCDS58717.1. [Q53GS9-3]
RefSeqiNP_001243654.1. NM_001256725.1. [Q53GS9-1]
NP_001243655.1. NM_001256726.1. [Q53GS9-3]
NP_001243656.1. NM_001256727.1.
NP_001243657.1. NM_001256728.1. [Q53GS9-2]
NP_006581.2. NM_006590.3. [Q53GS9-1]
XP_006711985.1. XM_006711922.1.
XP_006711986.1. XM_006711923.1.
UniGeneiHs.654745.

Genome annotation databases

EnsembliENST00000323701; ENSP00000312981; ENSG00000168883. [Q53GS9-1]
ENST00000409470; ENSP00000386864; ENSG00000168883. [Q53GS9-1]
ENST00000409766; ENSP00000386803; ENSG00000168883. [Q53GS9-3]
ENST00000450066; ENSP00000396133; ENSG00000168883. [Q53GS9-2]
GeneIDi10713.
KEGGihsa:10713.
UCSCiuc002sqb.4. human. [Q53GS9-1]
uc010fgo.4. human.
uc010ysv.3. human.

Polymorphism databases

DMDMi88909655.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF353989 mRNA. Translation: AAK49524.1 .
AF132955 mRNA. Translation: AAD27730.1 . Frameshift.
AK289451 mRNA. Translation: BAF82140.1 .
AK001047 mRNA. Translation: BAG50852.1 .
AK295257 mRNA. Translation: BAG58246.1 .
AK222852 mRNA. Translation: BAD96572.1 .
AC012454 Genomic DNA. No translation available.
AC016753 Genomic DNA. No translation available.
CH471053 Genomic DNA. Translation: EAW99490.1 .
CH471053 Genomic DNA. Translation: EAW99492.1 .
CH471053 Genomic DNA. Translation: EAW99493.1 .
CH471053 Genomic DNA. Translation: EAW99494.1 .
BC001384 mRNA. Translation: AAH01384.2 .
BC067273 mRNA. Translation: AAH67273.1 .
AF130096 mRNA. Translation: AAG35521.1 . Different initiation.
AF161450 mRNA. Translation: AAF29010.1 .
CCDSi CCDS33234.1. [Q53GS9-1 ]
CCDS58716.1. [Q53GS9-2 ]
CCDS58717.1. [Q53GS9-3 ]
RefSeqi NP_001243654.1. NM_001256725.1. [Q53GS9-1 ]
NP_001243655.1. NM_001256726.1. [Q53GS9-3 ]
NP_001243656.1. NM_001256727.1.
NP_001243657.1. NM_001256728.1. [Q53GS9-2 ]
NP_006581.2. NM_006590.3. [Q53GS9-1 ]
XP_006711985.1. XM_006711922.1.
XP_006711986.1. XM_006711923.1.
UniGenei Hs.654745.

3D structure databases

ProteinModelPortali Q53GS9.
SMRi Q53GS9. Positions 107-556.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115939. 79 interactions.
IntActi Q53GS9. 38 interactions.
MINTi MINT-4655337.
STRINGi 9606.ENSP00000312981.

Protein family/group databases

MEROPSi C19.972.

PTM databases

PhosphoSitei Q53GS9.

Polymorphism databases

DMDMi 88909655.

Proteomic databases

MaxQBi Q53GS9.
PaxDbi Q53GS9.
PeptideAtlasi Q53GS9.
PRIDEi Q53GS9.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000323701 ; ENSP00000312981 ; ENSG00000168883 . [Q53GS9-1 ]
ENST00000409470 ; ENSP00000386864 ; ENSG00000168883 . [Q53GS9-1 ]
ENST00000409766 ; ENSP00000386803 ; ENSG00000168883 . [Q53GS9-3 ]
ENST00000450066 ; ENSP00000396133 ; ENSG00000168883 . [Q53GS9-2 ]
GeneIDi 10713.
KEGGi hsa:10713.
UCSCi uc002sqb.4. human. [Q53GS9-1 ]
uc010fgo.4. human.
uc010ysv.3. human.

Organism-specific databases

CTDi 10713.
GeneCardsi GC02P085829.
HGNCi HGNC:20071. USP39.
HPAi HPA034823.
MIMi 611594. gene.
neXtProti NX_Q53GS9.
PharmGKBi PA134905136.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG259163.
GeneTreei ENSGT00390000007992.
HOVERGENi HBG079718.
InParanoidi Q53GS9.
KOi K12847.
OMAi AYTHSVQ.
OrthoDBi EOG7KH9JG.
PhylomeDBi Q53GS9.
TreeFami TF300610.

Miscellaneous databases

GeneWikii USP39.
GenomeRNAii 10713.
NextBioi 40671.
PROi Q53GS9.
SOURCEi Search...

Gene expression databases

Bgeei Q53GS9.
CleanExi HS_USP39.
ExpressionAtlasi Q53GS9. baseline and differential.
Genevestigatori Q53GS9.

Family and domain databases

Gene3Di 3.30.40.10. 1 hit.
InterProi IPR001394. Peptidase_C19_UCH.
IPR028889. UCH/PAN2.
IPR015880. Znf_C2H2-like.
IPR013083. Znf_RING/FYVE/PHD.
IPR001607. Znf_UBP.
[Graphical view ]
Pfami PF00443. UCH. 1 hit.
PF02148. zf-UBP. 1 hit.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 1 hit.
[Graphical view ]
PROSITEi PS50235. USP_3. 1 hit.
PS50271. ZF_UBP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The 65 and 110 kDa SR-related proteins of the U4/U6*U5 tri-snRNP are essential for the assembly of mature spliceosomes."
    Makarova O.V., Makarov E.M., Luehrmann R.
    EMBO J. 20:2553-2563(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION.
  2. "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
    Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
    Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Caudate nucleus and Embryo.
  4. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Liver.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Skin and Uterus.
  8. "Functional prediction of the coding sequences of 75 new genes deduced by analysis of cDNA clones from human fetal liver."
    Zhang C., Yu Y., Zhang S., Wei H., Bi J., Zhou G., Dong C., Zai Y., Xu W., Gao F., Liu M., He F.
    Submitted (FEB-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 104-565.
    Tissue: Fetal liver.
  9. "Human partial CDS from CD34+ stem cells."
    Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L., Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z.
    Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 305-565.
    Tissue: Umbilical cord blood.
  10. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. "The network of protein-protein interactions within the human U4/U6.U5 tri-snRNP."
    Liu S., Rauhut R., Vornlocher H.-P., Luehrmann R.
    RNA 12:1418-1430(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBUNIT.
  12. "Usp39 is essential for mitotic spindle checkpoint integrity and controls mRNA-levels of aurora B."
    van Leuken R.J., Luna-Vargas M.P., Sixma T.K., Wolthuis R.M., Medema R.H.
    Cell Cycle 7:2710-2719(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, ABSENCE OF UBIQUITIN-SPECIFIC PEPTIDASE ACTIVITY.
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSNUT2_HUMAN
AccessioniPrimary (citable) accession number: Q53GS9
Secondary accession number(s): A8K086
, B3KM40, B4DHT4, D6W5L4, G5E9H0, Q6NX47, Q96RK9, Q9BV89, Q9H381, Q9P050, Q9Y310
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2006
Last sequence update: February 21, 2006
Last modified: October 29, 2014
This is version 98 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3