Q53G59 (KLH12_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Kelch-like protein 12 Alternative name(s): CUL3-interacting protein 1 DKIR homolog Short name=hDKIR | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 568 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a negative regulator of Wnt signaling pathway and ER-Golgi transport. The BCR(KLHL12) complex is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31 (SEC31A or SEC31B). As part of the BCR(KLHL12) complex, also acts as a negative regulator of the Wnt signaling pathway by mediating ubiquitination and subsequent proteolysis of DVL3. The BCR(KLHL12) complex also mediates polyubiquitination of DRD4, without leading to degradation of DRD4. Ref.8 Ref.9 Ref.10 Ref.11 |
| Pathway | |
| Subunit structure | Component of the BCR(KLHL12) E3 ubiquitin ligase complex, at least composed of CUL3 and KLHL12 and RBX1. This complex interacts with DVL3 upon activation of the Wnt signaling pathway by WNT3A. Interacts with DRD4, KLHL12 and SEC31A. Ref.6 Ref.8 Ref.9 Ref.11 |
| Subcellular location | |
| Tissue specificity | Ubiquitously expressed. Highly expressed in testis and at lower levels in the submandibular salivary gland. Ref.6 Ref.7 |
| Domain | The BTB domain is required for interaction with CUL3. |
| Sequence similarities | Contains 1 BACK (BTB/Kelch associated) domain. Contains 1 BTB (POZ) domain. Contains 6 Kelch repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | ER-Golgi transport Transport Ubl conjugation pathway Wnt signaling pathway |
| Cellular component | Cytoplasmic vesicle |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Kelch repeat Repeat |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | COPII vesicle coating Inferred from mutant phenotype Ref.11. Source: UniProtKB Wnt receptor signaling pathwayInferred from mutant phenotype PubMed 20970343. Source: UniProtKB protein monoubiquitinationInferred from direct assay Ref.11. Source: UniProtKB |
| Cellular_component | Cul3-RING ubiquitin ligase complex Inferred from direct assay Ref.11. Source: UniProtKB ER to Golgi transport vesicleInferred from direct assay Ref.11. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATXN1 | P54253 | 2 | EBI-740929,EBI-930964 | |
| PEF1 | Q9UBV8 | 2 | EBI-740929,EBI-724639 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q53G59-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q53G59-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MDVNKFEASVGFLDVKKFLSTWKLQNPRTHFVLSPHCFM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 568 | 568 | Kelch-like protein 12 | PRO_0000234349 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 33 – 100 | 68 | BTB | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 135 – 236 | 102 | BACK | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 282 – 329 | 48 | Kelch 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 331 – 379 | 49 | Kelch 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 380 – 426 | 47 | Kelch 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 427 – 473 | 47 | Kelch 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 475 – 520 | 46 | Kelch 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 522 – 567 | 46 | Kelch 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 405 – 568 | 164 | Interaction with DVL3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MDVNKFEASVGFLDVKKFLS TWKLQNPRTHFVLSPHCFM in isoform 2. | VSP_042975 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 72 | 1 | P → L. Corresponds to variant rs12569087 [ dbSNP | Ensembl ]. | VAR_050049 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 289 – 290 | 2 | FG → AA: Abolishes interaction with SEC31A and subsequent monoubiquitination of SEC31A. Ref.11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 122 | 1 | C → R in BAD96792. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 197 – 198 | 2 | FE → LG in BAD96792. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 394 | 1 | T → A in BAD96792. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 281 – 286 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 291 – 293 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 299 – 303 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 304 – 307 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 308 – 311 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 323 – 327 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 330 – 334 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 346 – 350 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 360 – 362 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 373 – 377 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 380 – 384 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 395 – 400 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 401 – 404 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 405 – 411 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 420 – 424 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 427 – 431 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 443 – 446 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 448 – 450 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 453 – 456 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 467 – 471 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 474 – 478 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 483 – 486 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 490 – 494 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 495 – 498 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 499 – 503 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 514 – 518 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 521 – 525 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 530 – 541 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 542 – 545 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 546 – 559 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 561 – 566 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence of a novel kelch-like protein, C3IP1." Du M., Zu Z., Liou J.-Y., Chu K.-Y., Sansores Garcia L., Yeh E., Wu K.K. Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Teratocarcinoma, Testis and Thyroid. |
| [3] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney adenocarcinoma. |
| [6] | "hDKIR, a human homologue of the Drosophila kelch protein, involved in a ring-like structure." Mai A., Jung S.K., Yonehara S. Exp. Cell Res. 300:72-83(2004) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, INTERACTION WITH KLHL2. |
| [7] | "Identification of specific autoantigens in Sjoegren's syndrome by SEREX." Uchida K., Akita Y., Matsuo K., Fujiwara S., Nakagawa A., Kazaoka Y., Hachiya H., Naganawa Y., Oh-Iwa I., Ohura K., Saga S., Kawai T., Matsumoto Y., Shimozato K., Kozaki K. Immunology 116:53-63(2005) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [8] | "The KLHL12-cullin-3 ubiquitin ligase negatively regulates the Wnt-beta-catenin pathway by targeting Dishevelled for degradation." Angers S., Thorpe C.J., Biechele T.L., Goldenberg S.J., Zheng N., Maccoss M.J., Moon R.T. Nat. Cell Biol. 8:348-357(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION BY MASS SPECTROMETRY, INTERACTION WITH CUL3 AND DVL3. |
| [9] | "BTB Protein KLHL12 targets the dopamine D4 receptor for ubiquitination by a Cul3-based E3 ligase." Rondou P., Haegeman G., Vanhoenacker P., Van Craenenbroeck K. J. Biol. Chem. 283:11083-11096(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH DRD4. |
| [10] | "KLHL12-mediated ubiquitination of the dopamine D4 receptor does not target the receptor for degradation." Rondou P., Skieterska K., Packeu A., Lintermans B., Vanhoenacker P., Vauquelin G., Haegeman G., Van Craenenbroeck K. Cell. Signal. 22:900-913(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [11] | "Ubiquitin-dependent regulation of COPII coat size and function." Jin L., Pahuja K.B., Wickliffe K.E., Gorur A., Baumgartel C., Schekman R., Rape M. Nature 482:495-500(2012) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE BCR(KLHL12) COMPLEX, FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SEC31A, MUTAGENESIS OF 289-PHE-GLY-290. |
| [12] | "Structural basis for Cul3 assembly with the BTB-Kelch family of E3 ubiquitin ligases." Canning P., Cooper C.D., Krojer T., Murray J.W., Pike A.C., Chaikuad A., Keates T., Thangaratnarajah C., Hojzan V., Marsden B.D., Gileadi O., Knapp S., von Delft F., Bullock A.N. J. Biol. Chem. 0:0-0(2013) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 268-567. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF190900 mRNA. Translation: AAG17175.1. AK027656 mRNA. Translation: BAB55271.1. AK301791 mRNA. Translation: BAH13554.1. AK223072 mRNA. Translation: BAD96792.1. AC096632 Genomic DNA. No translation available. BC003183 mRNA. Translation: AAH03183.1. BC004175 mRNA. Translation: AAH04175.1. | ||||||||||||
| IPI | IPI00642182. IPI01011837. | ||||||||||||
| RefSeq | NP_067646.1. NM_021633.2. | ||||||||||||
| UniGene | Hs.706793. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q53G59. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q53G59. 20 interactions. | ||||||||||||
| MINT | MINT-1434520. | ||||||||||||
| STRING | 9606.ENSP00000356230. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q53G59. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 97054498. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q53G59. | ||||||||||||
| PRIDE | Q53G59. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 59349. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000367261; ENSP00000356230; ENSG00000117153. ENST00000435533; ENSP00000416886; ENSG00000117153. | ||||||||||||
| GeneID | 59349. | ||||||||||||
| KEGG | hsa:59349. | ||||||||||||
| UCSC | uc001gyn.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 59349. | ||||||||||||
| GeneCards | GC01M202860. | ||||||||||||
| HGNC | HGNC:19360. KLHL12. | ||||||||||||
| MIM | 614522. gene. | ||||||||||||
| neXtProt | NX_Q53G59. | ||||||||||||
| PharmGKB | PA134952416. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG73120. | ||||||||||||
| HOGENOM | HOG000230814. | ||||||||||||
| HOVERGEN | HBG014286. | ||||||||||||
| InParanoid | Q53G59. | ||||||||||||
| KO | K10450. | ||||||||||||
| OMA | RYDPHTG. | ||||||||||||
| OrthoDB | EOG4FJ88D. | ||||||||||||
| PhylomeDB | Q53G59. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| UniPathway | UPA00143. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q53G59. | ||||||||||||
| Bgee | Q53G59. | ||||||||||||
| CleanEx | HS_KLHL12. | ||||||||||||
| Genevestigator | Q53G59. | ||||||||||||
| GermOnline | ENSG00000117153. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.130.10.80. 1 hit. 3.30.710.10. 1 hit. | ||||||||||||
| InterPro | IPR011705. BACK. IPR000210. BTB/POZ-like. IPR011333. BTB/POZ_fold. IPR013069. BTB_POZ. IPR015916. Gal_Oxidase_b-propeller. IPR017096. Kelch-like_gigaxonin. IPR006652. Kelch_1. [Graphical view] | ||||||||||||
| Pfam | PF07707. BACK. 1 hit. PF00651. BTB. 1 hit. PF01344. Kelch_1. 6 hits. [Graphical view] | ||||||||||||
| PIRSF | PIRSF037037. Kelch-like_protein_gigaxonin. 1 hit. | ||||||||||||
| SMART | SM00875. BACK. 1 hit. SM00225. BTB. 1 hit. SM00612. Kelch. 6 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF54695. BTB/POZ_fold. 1 hit. | ||||||||||||
| PROSITE | PS50097. BTB. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | KLHL12. human. | ||||||||||||
| EvolutionaryTrace | Q53G59. | ||||||||||||
| GenomeRNAi | 59349. | ||||||||||||
| NextBio | 65257. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | KLH12_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q53G59 Secondary accession number(s): A6NEN8, B7Z7B8, Q9HBX5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
