Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kelch-like protein 12

Gene

KLHL12

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a negative regulator of Wnt signaling pathway and ER-Golgi transport (PubMed:22358839, PubMed:27565346). The BCR(KLHL12) complex is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31 (SEC31A or SEC31B) (PubMed:22358839, PubMed:27565346). As part of the BCR(KLHL12) complex, also acts as a negative regulator of the Wnt signaling pathway by mediating ubiquitination and subsequent proteolysis of DVL3 (PubMed:16547521). The BCR(KLHL12) complex also mediates polyubiquitination of DRD4, without leading to degradation of DRD4 (PubMed:18303015, PubMed:20100572).5 Publications

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functioni

  • identical protein binding Source: IntAct

GO - Biological processi

  • COPII vesicle coating Source: UniProtKB
  • ER to Golgi vesicle-mediated transport Source: UniProtKB
  • negative regulation of canonical Wnt signaling pathway Source: Reactome
  • protein monoubiquitination Source: UniProtKB
  • Wnt signaling pathway Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

ER-Golgi transport, Transport, Ubl conjugation pathway, Wnt signaling pathway

Enzyme and pathway databases

ReactomeiR-HSA-4641258. Degradation of DVL.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Kelch-like protein 12
Alternative name(s):
CUL3-interacting protein 1
DKIR homolog
Short name:
hDKIR
Gene namesi
Name:KLHL12
Synonyms:C3IP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:19360. KLHL12.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasmic vesicle

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi289 – 290FG → AA: Abolishes interaction with SEC31A and subsequent monoubiquitination of SEC31A. 1 Publication2

Organism-specific databases

DisGeNETi59349.
OpenTargetsiENSG00000117153.
PharmGKBiPA134952416.

Polymorphism and mutation databases

BioMutaiKLHL12.
DMDMi97054498.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002343491 – 568Kelch-like protein 12Add BLAST568

Proteomic databases

EPDiQ53G59.
MaxQBiQ53G59.
PaxDbiQ53G59.
PeptideAtlasiQ53G59.
PRIDEiQ53G59.

PTM databases

iPTMnetiQ53G59.
PhosphoSitePlusiQ53G59.

Expressioni

Tissue specificityi

Ubiquitously expressed. Highly expressed in testis and at lower levels in the submandibular salivary gland.2 Publications

Gene expression databases

BgeeiENSG00000117153.
CleanExiHS_KLHL12.
ExpressionAtlasiQ53G59. baseline and differential.
GenevisibleiQ53G59. HS.

Organism-specific databases

HPAiHPA071324.

Interactioni

Subunit structurei

Component of the BCR(KLHL12) E3 ubiquitin ligase complex, at least composed of CUL3 and KLHL12 and RBX1. This complex interacts with DVL3 upon activation of the Wnt signaling pathway by WNT3A. Interacts with DRD4, KLHL12 and SEC31A.4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
itself6EBI-740929,EBI-740929
ATXN1P542532EBI-740929,EBI-930964
BAG6P463794EBI-740929,EBI-347552
C1QTNF2Q9BXJ55EBI-740929,EBI-2817707
CARD10Q17RA13EBI-740929,EBI-10238571
CCBE1Q6UXH83EBI-740929,EBI-3923278
COL8A1P276583EBI-740929,EBI-747133
CUL3Q136185EBI-740929,EBI-456129
DVL3Q929973EBI-740929,EBI-739789
FGD2Q7Z6J43EBI-740929,EBI-1057190
FLNAP21333-23EBI-740929,EBI-9641086
GLYCTKQ8IVS83EBI-740929,EBI-748515
INMTO950505EBI-740929,EBI-10191038
KLHL2O951986EBI-740929,EBI-746999
KLHL3Q8N4I83EBI-740929,EBI-10230467
LNPQ9C0E8-24EBI-740929,EBI-11024283
LNX1Q8TBB13EBI-740929,EBI-739832
MPP1Q000135EBI-740929,EBI-711788
MRPL10Q7Z7H83EBI-740929,EBI-723524
PDGFRBP096195EBI-740929,EBI-641237
PEF1Q9UBV87EBI-740929,EBI-724639
PRR13Q9NZ816EBI-740929,EBI-740924
RPP25LQ8N5L85EBI-740929,EBI-10189722
SDCBPO005607EBI-740929,EBI-727004
SNX20Q7Z6144EBI-740929,EBI-744896
SYNE4Q8N2053EBI-740929,EBI-7131783
TBC1D10CQ8IV045EBI-740929,EBI-10261452
TTBK2Q6IQ555EBI-740929,EBI-1050303
UBE2IQ7KZS03EBI-740929,EBI-10180829
VEGFBQ7LAP43EBI-740929,EBI-10256629
WDYHV1Q96HA87EBI-740929,EBI-741158
ZBP1A2RRL93EBI-740929,EBI-10173066

GO - Molecular functioni

  • identical protein binding Source: IntAct

Protein-protein interaction databases

BioGridi121890. 57 interactors.
IntActiQ53G59. 69 interactors.
MINTiMINT-1434520.
STRINGi9606.ENSP00000356230.

Structurei

Secondary structure

1568
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi281 – 286Combined sources6
Turni291 – 293Combined sources3
Beta strandi299 – 303Combined sources5
Turni304 – 307Combined sources4
Beta strandi308 – 311Combined sources4
Beta strandi323 – 327Combined sources5
Beta strandi330 – 334Combined sources5
Beta strandi346 – 350Combined sources5
Beta strandi360 – 362Combined sources3
Beta strandi373 – 377Combined sources5
Beta strandi380 – 384Combined sources5
Beta strandi395 – 400Combined sources6
Turni401 – 404Combined sources4
Beta strandi405 – 411Combined sources7
Beta strandi420 – 424Combined sources5
Beta strandi427 – 431Combined sources5
Beta strandi443 – 446Combined sources4
Turni448 – 450Combined sources3
Beta strandi453 – 456Combined sources4
Beta strandi467 – 471Combined sources5
Beta strandi474 – 478Combined sources5
Beta strandi483 – 486Combined sources4
Beta strandi490 – 494Combined sources5
Turni495 – 498Combined sources4
Beta strandi499 – 503Combined sources5
Beta strandi514 – 518Combined sources5
Beta strandi521 – 525Combined sources5
Beta strandi530 – 541Combined sources12
Turni542 – 545Combined sources4
Beta strandi546 – 559Combined sources14
Beta strandi561 – 566Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2VPJX-ray1.85A268-567[»]
ProteinModelPortaliQ53G59.
SMRiQ53G59.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ53G59.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini33 – 100BTBPROSITE-ProRule annotationAdd BLAST68
Domaini135 – 236BACKAdd BLAST102
Repeati282 – 329Kelch 1Add BLAST48
Repeati331 – 379Kelch 2Add BLAST49
Repeati380 – 426Kelch 3Add BLAST47
Repeati427 – 473Kelch 4Add BLAST47
Repeati475 – 520Kelch 5Add BLAST46
Repeati522 – 567Kelch 6Add BLAST46

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni405 – 568Interaction with DVL31 PublicationAdd BLAST164

Domaini

The BTB domain is required for interaction with CUL3.

Sequence similaritiesi

Contains 1 BTB (POZ) domain.PROSITE-ProRule annotation
Contains 6 Kelch repeats.Curated

Keywords - Domaini

Kelch repeat, Repeat

Phylogenomic databases

eggNOGiKOG4441. Eukaryota.
ENOG410XNX8. LUCA.
GeneTreeiENSGT00760000118931.
HOGENOMiHOG000230814.
HOVERGENiHBG014286.
InParanoidiQ53G59.
KOiK10450.
OMAiTEPFIRC.
OrthoDBiEOG091G04QJ.
PhylomeDBiQ53G59.
TreeFamiTF329218.

Family and domain databases

Gene3Di2.130.10.80. 1 hit.
InterProiIPR011705. BACK.
IPR017096. BTB-kelch_protein.
IPR000210. BTB/POZ_dom.
IPR015916. Gal_Oxidase_b-propeller.
IPR006652. Kelch_1.
IPR011333. SKP1/BTB/POZ.
[Graphical view]
PfamiPF07707. BACK. 1 hit.
PF00651. BTB. 1 hit.
PF01344. Kelch_1. 6 hits.
[Graphical view]
PIRSFiPIRSF037037. Kelch-like_protein_gigaxonin. 1 hit.
SMARTiSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q53G59-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGIMAPKDI MTNTHAKSIL NSMNSLRKSN TLCDVTLRVE QKDFPAHRIV
60 70 80 90 100
LAACSDYFCA MFTSELSEKG KPYVDIQGLT ASTMEILLDF VYTETVHVTV
110 120 130 140 150
ENVQELLPAA CLLQLKGVKQ ACCEFLESQL DPSNCLGIRD FAETHNCVDL
160 170 180 190 200
MQAAEVFSQK HFPEVVQHEE FILLSQGEVE KLIKCDEIQV DSEEPVFEAV
210 220 230 240 250
INWVKHAKKE REESLPNLLQ YVRMPLLTPR YITDVIDAEP FIRCSLQCRD
260 270 280 290 300
LVDEAKKFHL RPELRSQMQG PRTRARLGAN EVLLVVGGFG SQQSPIDVVE
310 320 330 340 350
KYDPKTQEWS FLPSITRKRR YVASVSLHDR IYVIGGYDGR SRLSSVECLD
360 370 380 390 400
YTADEDGVWY SVAPMNVRRG LAGATTLGDM IYVSGGFDGS RRHTSMERYD
410 420 430 440 450
PNIDQWSMLG DMQTAREGAG LVVASGVIYC LGGYDGLNIL NSVEKYDPHT
460 470 480 490 500
GHWTNVTPMA TKRSGAGVAL LNDHIYVVGG FDGTAHLSSV EAYNIRTDSW
510 520 530 540 550
TTVTSMTTPR CYVGATVLRG RLYAIAGYDG NSLLSSIECY DPIIDSWEVV
560
TSMGTQRCDA GVCVLREK
Length:568
Mass (Da):63,277
Last modified:May 16, 2006 - v2
Checksum:i4EB1BC33B6351B5D
GO
Isoform 2 (identifier: Q53G59-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDVNKFEASVGFLDVKKFLSTWKLQNPRTHFVLSPHCFM

Show »
Length:606
Mass (Da):67,727
Checksum:i47F91BE5B8ED7C33
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti122C → R in BAD96792 (Ref. 3) Curated1
Sequence conflicti197 – 198FE → LG in BAD96792 (Ref. 3) Curated2
Sequence conflicti394T → A in BAD96792 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05004972P → L.Corresponds to variant rs12569087dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0429751M → MDVNKFEASVGFLDVKKFLS TWKLQNPRTHFVLSPHCFM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF190900 mRNA. Translation: AAG17175.1.
AK027656 mRNA. Translation: BAB55271.1.
AK301791 mRNA. Translation: BAH13554.1.
AK223072 mRNA. Translation: BAD96792.1.
AC096632 Genomic DNA. No translation available.
BC003183 mRNA. Translation: AAH03183.1.
BC004175 mRNA. Translation: AAH04175.1.
CCDSiCCDS1429.1. [Q53G59-1]
RefSeqiNP_001289980.1. NM_001303051.1. [Q53G59-2]
NP_001290038.1. NM_001303109.1.
NP_067646.1. NM_021633.3. [Q53G59-1]
UniGeneiHs.706793.

Genome annotation databases

EnsembliENST00000367261; ENSP00000356230; ENSG00000117153. [Q53G59-1]
GeneIDi59349.
KEGGihsa:59349.
UCSCiuc001gyo.2. human. [Q53G59-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF190900 mRNA. Translation: AAG17175.1.
AK027656 mRNA. Translation: BAB55271.1.
AK301791 mRNA. Translation: BAH13554.1.
AK223072 mRNA. Translation: BAD96792.1.
AC096632 Genomic DNA. No translation available.
BC003183 mRNA. Translation: AAH03183.1.
BC004175 mRNA. Translation: AAH04175.1.
CCDSiCCDS1429.1. [Q53G59-1]
RefSeqiNP_001289980.1. NM_001303051.1. [Q53G59-2]
NP_001290038.1. NM_001303109.1.
NP_067646.1. NM_021633.3. [Q53G59-1]
UniGeneiHs.706793.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2VPJX-ray1.85A268-567[»]
ProteinModelPortaliQ53G59.
SMRiQ53G59.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121890. 57 interactors.
IntActiQ53G59. 69 interactors.
MINTiMINT-1434520.
STRINGi9606.ENSP00000356230.

PTM databases

iPTMnetiQ53G59.
PhosphoSitePlusiQ53G59.

Polymorphism and mutation databases

BioMutaiKLHL12.
DMDMi97054498.

Proteomic databases

EPDiQ53G59.
MaxQBiQ53G59.
PaxDbiQ53G59.
PeptideAtlasiQ53G59.
PRIDEiQ53G59.

Protocols and materials databases

DNASUi59349.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000367261; ENSP00000356230; ENSG00000117153. [Q53G59-1]
GeneIDi59349.
KEGGihsa:59349.
UCSCiuc001gyo.2. human. [Q53G59-1]

Organism-specific databases

CTDi59349.
DisGeNETi59349.
GeneCardsiKLHL12.
HGNCiHGNC:19360. KLHL12.
HPAiHPA071324.
MIMi614522. gene.
neXtProtiNX_Q53G59.
OpenTargetsiENSG00000117153.
PharmGKBiPA134952416.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4441. Eukaryota.
ENOG410XNX8. LUCA.
GeneTreeiENSGT00760000118931.
HOGENOMiHOG000230814.
HOVERGENiHBG014286.
InParanoidiQ53G59.
KOiK10450.
OMAiTEPFIRC.
OrthoDBiEOG091G04QJ.
PhylomeDBiQ53G59.
TreeFamiTF329218.

Enzyme and pathway databases

UniPathwayiUPA00143.
ReactomeiR-HSA-4641258. Degradation of DVL.

Miscellaneous databases

ChiTaRSiKLHL12. human.
EvolutionaryTraceiQ53G59.
GeneWikiiKLHL12.
GenomeRNAii59349.
PROiQ53G59.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000117153.
CleanExiHS_KLHL12.
ExpressionAtlasiQ53G59. baseline and differential.
GenevisibleiQ53G59. HS.

Family and domain databases

Gene3Di2.130.10.80. 1 hit.
InterProiIPR011705. BACK.
IPR017096. BTB-kelch_protein.
IPR000210. BTB/POZ_dom.
IPR015916. Gal_Oxidase_b-propeller.
IPR006652. Kelch_1.
IPR011333. SKP1/BTB/POZ.
[Graphical view]
PfamiPF07707. BACK. 1 hit.
PF00651. BTB. 1 hit.
PF01344. Kelch_1. 6 hits.
[Graphical view]
PIRSFiPIRSF037037. Kelch-like_protein_gigaxonin. 1 hit.
SMARTiSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKLH12_HUMAN
AccessioniPrimary (citable) accession number: Q53G59
Secondary accession number(s): A6NEN8, B7Z7B8, Q9HBX5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: May 16, 2006
Last modified: November 30, 2016
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.