Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q53FZ2

- ACSM3_HUMAN

UniProt

Q53FZ2 - ACSM3_HUMAN

Protein

Acyl-coenzyme A synthetase ACSM3, mitochondrial

Gene

ACSM3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 85 (01 Oct 2014)
      Sequence version 2 (02 Oct 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C4 to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro) By similarity.By similarity

    Catalytic activityi

    ATP + a carboxylate + CoA = AMP + diphosphate + an acyl-CoA.

    Cofactori

    Magnesium.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei461 – 4611ATPBy similarity
    Binding sitei476 – 4761ATPBy similarity
    Binding sitei572 – 5721ATPBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi235 – 2439ATPBy similarity
    Nucleotide bindingi374 – 3796ATPBy similarity

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. butyrate-CoA ligase activity Source: UniProtKB-EC
    3. fatty acid ligase activity Source: Ensembl
    4. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. cholesterol homeostasis Source: BHF-UCL
    2. fatty acid biosynthetic process Source: Ensembl
    3. regulation of blood pressure Source: UniProtKB

    Keywords - Molecular functioni

    Ligase

    Keywords - Biological processi

    Fatty acid metabolism, Lipid metabolism

    Keywords - Ligandi

    ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Acyl-coenzyme A synthetase ACSM3, mitochondrial (EC:6.2.1.2)
    Alternative name(s):
    Acyl-CoA synthetase medium-chain family member 3
    Butyrate--CoA ligase 3
    Butyryl-coenzyme A synthetase 3
    Middle-chain acyl-CoA synthetase 3
    Protein SA homolog
    Gene namesi
    Name:ACSM3
    Synonyms:SAH
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:10522. ACSM3.

    Subcellular locationi

    Mitochondrion matrix By similarity

    GO - Cellular componenti

    1. mitochondrial matrix Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Mitochondrion

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA34930.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transit peptidei1 – 2727MitochondrionSequence AnalysisAdd
    BLAST
    Chaini28 – 586559Acyl-coenzyme A synthetase ACSM3, mitochondrialPRO_0000306097Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei73 – 731N6-succinyllysineBy similarity
    Modified residuei106 – 1061N6-succinyllysineBy similarity
    Modified residuei157 – 1571N6-acetyllysineBy similarity

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ53FZ2.
    PaxDbiQ53FZ2.
    PRIDEiQ53FZ2.

    PTM databases

    PhosphoSiteiQ53FZ2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ53FZ2.
    BgeeiQ53FZ2.
    CleanExiHS_ACSM3.
    GenevestigatoriQ53FZ2.

    Organism-specific databases

    HPAiHPA041013.

    Interactioni

    Protein-protein interaction databases

    BioGridi112203. 1 interaction.
    IntActiQ53FZ2. 1 interaction.
    STRINGi9606.ENSP00000289416.

    Structurei

    3D structure databases

    ProteinModelPortaliQ53FZ2.
    SMRiQ53FZ2. Positions 54-584.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    eggNOGiCOG0365.
    HOGENOMiHOG000229982.
    HOVERGENiHBG053031.
    InParanoidiQ53FZ2.
    KOiK01896.
    OMAiYAIVDEN.
    OrthoDBiEOG7D85VZ.
    PhylomeDBiQ53FZ2.
    TreeFamiTF354287.

    Family and domain databases

    InterProiIPR025110. AMP-bd_C.
    IPR020845. AMP-binding_CS.
    IPR000873. AMP-dep_Synth/Lig.
    [Graphical view]
    PfamiPF00501. AMP-binding. 1 hit.
    PF13193. AMP-binding_C. 1 hit.
    [Graphical view]
    PROSITEiPS00455. AMP_BINDING. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q53FZ2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLARVTRKML RHAKCFQRLA IFGSVRALHK DNRTATPQNF SNYESMKQDF    50
    KLGIPEYFNF AKDVLDQWTD KEKAGKKPSN PAFWWINRNG EEMRWSFEEL 100
    GSLSRKFANI LSEACSLQRG DRVILILPRV PEWWLANVAC LRTGTVLIPG 150
    TTQLTQKDIL YRLQSSKANC IITNDVLAPA VDAVASKCEN LHSKLIVSEN 200
    SREGWGNLKE LMKHASDSHT CVKTKHNEIM AIFFTSGTSG YPKMTAHTHS 250
    SFGLGLSVNG RFWLDLTPSD VMWNTSDTGW AKSAWSSVFS PWIQGACVFT 300
    HHLPRFEPTS ILQTLSKYPI TVFCSAPTVY RMLVQNDITS YKFKSLKHCV 350
    SAGEPITPDV TEKWRNKTGL DIYEGYGQTE TVLICGNFKG MKIKPGSMGK 400
    PSPAFDVKIV DVNGNVLPPG QEGDIGIQVL PNRPFGLFTH YVDNPSKTAS 450
    TLRGNFYITG DRGYMDKDGY FWFVARADDV ILSSGYRIGP FEVENALNEH 500
    PSVAESAVVS SPDPIRGEVV KAFVVLNPDY KSHDQEQLIK EIQEHVKKTT 550
    APYKYPRKVE FIQELPKTIS GKTKRNELRK KEWKTI 586
    Length:586
    Mass (Da):66,153
    Last modified:October 2, 2007 - v2
    Checksum:i329967C751F11F1D
    GO
    Isoform 2 (identifier: Q53FZ2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         409-438: IVDVNGNVLPPGQEGDIGIQVLPNRPFGLF → VCTSPSRRMFNNPICTLPTYRLPPYKLSLL
         439-586: Missing.

    Show »
    Length:438
    Mass (Da):49,485
    Checksum:iA94538369727118F
    GO

    Sequence cautioni

    The sequence AAC31667.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA03853.1 differs from that shown. Reason: Erroneous initiation.
    The sequence CAA56369.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti132 – 1321E → R in BAA03853. (PubMed:7907320)Curated
    Sequence conflicti237 – 2371G → A in BAA03853. (PubMed:7907320)Curated
    Sequence conflicti245 – 2451T → S in BAA03853. (PubMed:7907320)Curated
    Sequence conflicti407 – 4071V → D in BAD96859. 1 PublicationCurated
    Sequence conflicti463 – 4631G → A in BAA03853. (PubMed:7907320)Curated
    Sequence conflicti569 – 5691I → V in BAA03853. (PubMed:7907320)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti100 – 1001L → P.
    Corresponds to variant rs5713 [ dbSNP | Ensembl ].
    VAR_035249
    Natural varianti270 – 2701D → H.
    Corresponds to variant rs13306603 [ dbSNP | Ensembl ].
    VAR_048239
    Natural varianti308 – 3081P → T.
    Corresponds to variant rs7196188 [ dbSNP | Ensembl ].
    VAR_035250
    Natural varianti367 – 3671K → N.2 Publications
    Corresponds to variant rs5716 [ dbSNP | Ensembl ].
    VAR_035251

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei409 – 43830IVDVN…PFGLF → VCTSPSRRMFNNPICTLPTY RLPPYKLSLL in isoform 2. 2 PublicationsVSP_028395Add
    BLAST
    Alternative sequencei439 – 586148Missing in isoform 2. 2 PublicationsVSP_028396Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D16350 mRNA. Translation: BAA03853.1. Different initiation.
    X80062 mRNA. Translation: CAA56369.1. Different initiation.
    AC004381 Genomic DNA. Translation: AAC31667.1. Different initiation.
    AK223139 mRNA. Translation: BAD96859.1.
    BC002790 mRNA. Translation: AAH02790.3.
    CCDSiCCDS10589.1. [Q53FZ2-1]
    CCDS45435.1. [Q53FZ2-2]
    PIRiI54401.
    S69913.
    RefSeqiNP_005613.2. NM_005622.3. [Q53FZ2-1]
    NP_973729.1. NM_202000.2. [Q53FZ2-2]
    UniGeneiHs.706754.

    Genome annotation databases

    EnsembliENST00000289416; ENSP00000289416; ENSG00000005187. [Q53FZ2-1]
    ENST00000440284; ENSP00000394565; ENSG00000005187. [Q53FZ2-2]
    GeneIDi6296.
    KEGGihsa:6296.
    UCSCiuc002dhq.3. human. [Q53FZ2-2]
    uc002dhr.3. human. [Q53FZ2-1]

    Polymorphism databases

    DMDMi158706483.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D16350 mRNA. Translation: BAA03853.1 . Different initiation.
    X80062 mRNA. Translation: CAA56369.1 . Different initiation.
    AC004381 Genomic DNA. Translation: AAC31667.1 . Different initiation.
    AK223139 mRNA. Translation: BAD96859.1 .
    BC002790 mRNA. Translation: AAH02790.3 .
    CCDSi CCDS10589.1. [Q53FZ2-1 ]
    CCDS45435.1. [Q53FZ2-2 ]
    PIRi I54401.
    S69913.
    RefSeqi NP_005613.2. NM_005622.3. [Q53FZ2-1 ]
    NP_973729.1. NM_202000.2. [Q53FZ2-2 ]
    UniGenei Hs.706754.

    3D structure databases

    ProteinModelPortali Q53FZ2.
    SMRi Q53FZ2. Positions 54-584.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 112203. 1 interaction.
    IntActi Q53FZ2. 1 interaction.
    STRINGi 9606.ENSP00000289416.

    PTM databases

    PhosphoSitei Q53FZ2.

    Polymorphism databases

    DMDMi 158706483.

    Proteomic databases

    MaxQBi Q53FZ2.
    PaxDbi Q53FZ2.
    PRIDEi Q53FZ2.

    Protocols and materials databases

    DNASUi 6296.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000289416 ; ENSP00000289416 ; ENSG00000005187 . [Q53FZ2-1 ]
    ENST00000440284 ; ENSP00000394565 ; ENSG00000005187 . [Q53FZ2-2 ]
    GeneIDi 6296.
    KEGGi hsa:6296.
    UCSCi uc002dhq.3. human. [Q53FZ2-2 ]
    uc002dhr.3. human. [Q53FZ2-1 ]

    Organism-specific databases

    CTDi 6296.
    GeneCardsi GC16P020683.
    H-InvDB HIX0079728.
    HIX0079834.
    HGNCi HGNC:10522. ACSM3.
    HPAi HPA041013.
    MIMi 145505. gene.
    neXtProti NX_Q53FZ2.
    PharmGKBi PA34930.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0365.
    HOGENOMi HOG000229982.
    HOVERGENi HBG053031.
    InParanoidi Q53FZ2.
    KOi K01896.
    OMAi YAIVDEN.
    OrthoDBi EOG7D85VZ.
    PhylomeDBi Q53FZ2.
    TreeFami TF354287.

    Miscellaneous databases

    ChiTaRSi ACSM3. human.
    GeneWikii ACSM3.
    GenomeRNAii 6296.
    NextBioi 24443.
    PROi Q53FZ2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q53FZ2.
    Bgeei Q53FZ2.
    CleanExi HS_ACSM3.
    Genevestigatori Q53FZ2.

    Family and domain databases

    InterProi IPR025110. AMP-bd_C.
    IPR020845. AMP-binding_CS.
    IPR000873. AMP-dep_Synth/Lig.
    [Graphical view ]
    Pfami PF00501. AMP-binding. 1 hit.
    PF13193. AMP-binding_C. 1 hit.
    [Graphical view ]
    PROSITEi PS00455. AMP_BINDING. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Human SA gene locus as a candidate locus for essential hypertension."
      Iwai N., Ohmichi N., Hanai K., Nakamura Y., Kinoshita M.
      Hypertension 23:375-380(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Liver.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), LACK OF INVOLVEMENT IN HEREDITARY HYPERTENSION.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-367.
      Tissue: Kidney.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Skin.
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. Cited for: VARIANT ASN-367.

    Entry informationi

    Entry nameiACSM3_HUMAN
    AccessioniPrimary (citable) accession number: Q53FZ2
    Secondary accession number(s): O60363
    , Q13732, Q15425, Q7KYM6, Q9BUA2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 2, 2007
    Last sequence update: October 2, 2007
    Last modified: October 1, 2014
    This is version 85 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Caution

    It is uncertain whether Met-1 or Met-9 is the initiator.Curated

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3