Q53FZ2 (ACSM3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 60.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Acyl-coenzyme A synthetase ACSM3, mitochondrial EC=6.2.1.2 Alternative name(s): Acyl-CoA synthetase medium-chain family member 3 Butyrate--CoA ligase 3 Butyryl-coenzyme A synthetase 3 Middle-chain acyl-CoA synthetase 3 Protein SA homolog | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 586 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C4 to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro) By similarity. |
| Catalytic activity | ATP + an acid + CoA = AMP + diphosphate + an acyl-CoA. |
| Cofactor | Magnesium By similarity. |
| Subcellular location | Mitochondrion matrix By similarity. |
| Sequence similarities | Belongs to the ATP-dependent AMP-binding enzyme family. |
| Caution | It is uncertain whether Met-1 or Met-9 is the initiator. |
| Sequence caution | The sequence AAC31667.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA03853.1 differs from that shown. Reason: Erroneous initiation. The sequence CAA56369.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Fatty acid metabolism Lipid metabolism |
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transit peptide |
| Ligand | ATP-binding Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Ligase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | regulation of blood pressure Non-traceable author statement Ref.1. Source: UniProtKB |
| Cellular component | mitochondrial matrix Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW butyrate-CoA ligase activityInferred from electronic annotation. Source: EC metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q53FZ2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q53FZ2-2) The sequence of this isoform differs from the canonical sequence as follows: 409-438: IVDVNGNVLPPGQEGDIGIQVLPNRPFGLF → VCTSPSRRMFNNPICTLPTYRLPPYKLSLL 439-586: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 27 | 27 | Mitochondrion Potential | ||||||
| Chain | 28 – 586 | 559 | Acyl-coenzyme A synthetase ACSM3, mitochondrial | PRO_0000306097 | |||||
Regions | |||||||||
| Nucleotide binding | 235 – 243 | 9 | ATP By similarity | ||||||
| Nucleotide binding | 374 – 379 | 6 | ATP By similarity | ||||||
Sites | |||||||||
| Binding site | 461 | 1 | ATP By similarity | ||||||
| Binding site | 476 | 1 | ATP By similarity | ||||||
| Binding site | 572 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 43 | 1 | Phosphotyrosine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 409 – 438 | 30 | IVDVN…PFGLF → VCTSPSRRMFNNPICTLPTY RLPPYKLSLL in isoform 2. | VSP_028395 | |||||
| Alternative sequence | 439 – 586 | 148 | Missing in isoform 2. | VSP_028396 | |||||
| Natural variant | 100 | 1 | L → P. Corresponds to variant rs5713 [ dbSNP | Ensembl ]. | VAR_035249 | |||||
| Natural variant | 270 | 1 | D → H. Corresponds to variant rs13306603 [ dbSNP | Ensembl ]. | VAR_048239 | |||||
| Natural variant | 308 | 1 | P → T. Corresponds to variant rs7196188 [ dbSNP | Ensembl ]. | VAR_035250 | |||||
| Natural variant | 367 | 1 | K → N. Ref.4 Ref.8 Corresponds to variant rs5716 [ dbSNP | Ensembl ]. | VAR_035251 | |||||
Experimental info | |||||||||
| Sequence conflict | 132 | 1 | E → R in BAA03853. Ref.1 | ||||||
| Sequence conflict | 237 | 1 | G → A in BAA03853. Ref.1 | ||||||
| Sequence conflict | 245 | 1 | T → S in BAA03853. Ref.1 | ||||||
| Sequence conflict | 407 | 1 | V → D in BAD96859. Ref.4 | ||||||
| Sequence conflict | 463 | 1 | G → A in BAA03853. Ref.1 | ||||||
| Sequence conflict | 569 | 1 | I → V in BAA03853. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human SA gene locus as a candidate locus for essential hypertension." Iwai N., Ohmichi N., Hanai K., Nakamura Y., Kinoshita M. Hypertension 23:375-380(1994) [PubMed: 7907320] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [2] | "Evaluation of the SA locus in human hypertension." Nabika T., Bonnardeaux A., James M., Julier C., Jeunemaitre X., Corvol P., Lathrop M., Soubrier F. Hypertension 25:6-13(1995) [PubMed: 7843754] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), LACK OF INVOLVEMENT IN HEREDITARY HYPERTENSION. |
| [3] | "Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q." Loftus B.J., Kim U.-J., Sneddon V.P., Kalush F., Brandon R., Fuhrmann J., Mason T., Crosby M.L., Barnstead M., Cronin L., Mays A.D., Cao Y., Xu R.X., Kang H.-L., Mitchell S., Eichler E.E., Harris P.C., Venter J.C., Adams M.D. Genomics 60:295-308(1999) [PubMed: 10493829] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASN-367. Tissue: Kidney. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Skin. |
| [6] | "Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction." Tang L.-Y., Deng N., Wang L.-S., Dai J., Wang Z.-L., Jiang X.-S., Li S.-J., Li L., Sheng Q.-H., Wu D.-Q., Li L., Zeng R. Mol. Cell. Proteomics 6:1952-1967(2007) [PubMed: 17693683] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-43, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [8] | "SAH gene variants are associated with obesity-related hypertension in Caucasians: the PEGASE Study." Telgmann R., Brand E., Nicaud V., Hagedorn C., Beining K., Schoenfelder J., Brink-Spalink V., Schmidt-Petersen K., Matanis T., Vischer P., Nofer J.-R., Hasenkamp S., Plouin P.-F., Drouet L., Cambien F., Paul M., Tiret L., Brand-Herrmann S.-M. J. Hypertens. 25:557-564(2007) [PubMed: 17278971] [Abstract] Cited for: VARIANT ASN-367. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D16350 mRNA. Translation: BAA03853.1. Different initiation. X80062 mRNA. Translation: CAA56369.1. Different initiation. AC004381 Genomic DNA. Translation: AAC31667.1. Different initiation. AK223139 mRNA. Translation: BAD96859.1. BC002790 mRNA. Translation: AAH02790.3. |
| IPI | IPI00297635. IPI00402513. |
| PIR | I54401. S69913. |
| RefSeq | NP_005613.2. NM_005622.3. NP_973729.1. NM_202000.2. |
| UniGene | Hs.706754. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1LCI based on UniProtKB P08659. |
| ProteinModelPortal | Q53FZ2. |
| SMR | Q53FZ2. Positions 51-584. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q53FZ2. |
Polymorphism databases | |
| DMDM | 158706483. |
Proteomic databases | |
| PRIDE | Q53FZ2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000289416; ENSP00000289416; ENSG00000005187. |
| GeneID | 6296. |
| KEGG | hsa:6296. |
| NMPDR | fig|9606.3.peg.11829. |
| UCSC | uc002dhq.1. human. uc002dhr.1. human. |
Organism-specific databases | |
| CTD | 6296. |
| GeneCards | GC16P020775. |
| H-InvDB | HIX0079728. HIX0079834. |
| HGNC | HGNC:10522. ACSM3. |
| HPA | HPA041013. |
| MIM | 145505. gene. |
| neXtProt | NX_Q53FZ2. |
| PharmGKB | PA34930. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG09625. |
| GeneTree | ENSGT00550000074278. |
| HOGENOM | HBG547964. |
| HOVERGEN | HBG053031. |
| InParanoid | Q53FZ2. |
| OMA | KFPITVF. |
| OrthoDB | EOG4ZPDTX. |
| PhylomeDB | Q53FZ2. |
Gene expression databases | |
| ArrayExpress | Q53FZ2. |
| Bgee | Q53FZ2. |
| CleanEx | HS_ACSM3. |
| Genevestigator | Q53FZ2. |
Family and domain databases | |
| InterPro | IPR020845. AMP-binding_CS. IPR000873. AMP-dep_Synth/Lig. [Graphical view] |
| KO | K01896. |
| Pfam | PF00501. AMP-binding. 1 hit. [Graphical view] |
| PROSITE | PS00455. AMP_BINDING. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 24443. |
| SOURCE | Search... |
Entry information
| Entry name | ACSM3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q53FZ2 Secondary accession number(s): O60363 Q9BUA2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with