Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q53F39

- MPPE1_HUMAN

UniProt

Q53F39 - MPPE1_HUMAN

Protein

Metallophosphoesterase 1

Gene

MPPE1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 78 (01 Oct 2014)
      Sequence version 2 (25 Nov 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Metallophosphoesterase required for transport of GPI-anchor proteins from the endoplasmic reticulum to the Golgi. Acts in lipid remodeling steps of GPI-anchor maturation by mediating the removal of a side-chain ethanolamine-phosphate (EtNP) from the second Man (Man2) of the GPI intermediate, an essential step for efficient transport of GPI-anchor proteins.1 Publication

    Cofactori

    Binds 2 manganese ions per subunit.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi77 – 771Divalent metal cation 2Curated
    Metal bindingi119 – 1191Divalent metal cation 1Curated
    Metal bindingi119 – 1191Divalent metal cation 2Curated
    Metal bindingi157 – 1571Divalent metal cation 1Curated
    Metal bindingi249 – 2491Divalent metal cation 1Curated
    Metal bindingi303 – 3031Divalent metal cation 1Curated
    Metal bindingi305 – 3051Divalent metal cation 2Curated

    GO - Molecular functioni

    1. GPI anchor binding Source: UniProtKB
    2. manganese ion binding Source: UniProtKB
    3. phosphoric diester hydrolase activity Source: UniProtKB

    GO - Biological processi

    1. ER to Golgi vesicle-mediated transport Source: UniProtKB
    2. GPI anchor biosynthetic process Source: UniProtKB

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Biological processi

    ER-Golgi transport, GPI-anchor biosynthesis, Transport

    Keywords - Ligandi

    Manganese, Metal-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Metallophosphoesterase 1 (EC:3.1.-.-)
    Alternative name(s):
    Post-GPI attachment to proteins factor 5
    Gene namesi
    Name:MPPE1
    Synonyms:PGAP5
    ORF Names:PP579
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 18

    Organism-specific databases

    HGNCiHGNC:15988. MPPE1.

    Subcellular locationi

    Endoplasmic reticulum-Golgi intermediate compartment membrane 1 Publication; Multi-pass membrane protein 1 Publication. Golgi apparatuscis-Golgi network membrane 1 Publication; Multi-pass membrane protein 1 Publication
    Note: Also localizes to endoplasmic reticulum exit site.

    GO - Cellular componenti

    1. cis-Golgi network Source: UniProtKB
    2. endoplasmic reticulum exit site Source: UniProtKB
    3. endoplasmic reticulum-Golgi intermediate compartment Source: UniProtKB
    4. endoplasmic reticulum-Golgi intermediate compartment membrane Source: UniProtKB-SubCell
    5. Golgi apparatus Source: UniProtKB-SubCell
    6. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi77 – 771D → A: Affects transport of GPI-anchor proteins. 1 Publication
    Mutagenesisi79 – 791H → A: Affects transport of GPI-anchor proteins. 1 Publication
    Mutagenesisi119 – 1191D → A or N: Affects transport of GPI-anchor proteins. 1 Publication
    Mutagenesisi157 – 1571N → A: Affects transport of GPI-anchor proteins. 1 Publication
    Mutagenesisi158 – 1581H → A: Affects transport of GPI-anchor proteins. 1 Publication
    Mutagenesisi249 – 2491H → A: Affects transport of GPI-anchor proteins. 1 Publication
    Mutagenesisi303 – 3031H → A: Affects transport of GPI-anchor proteins. 1 Publication
    Mutagenesisi305 – 3051H → A: Affects transport of GPI-anchor proteins. 1 Publication
    Mutagenesisi392 – 3943KRK → ARA: Affects subcellular localization.

    Organism-specific databases

    PharmGKBiPA134913534.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 396396Metallophosphoesterase 1PRO_0000315727Add
    BLAST

    Proteomic databases

    MaxQBiQ53F39.
    PaxDbiQ53F39.
    PRIDEiQ53F39.

    PTM databases

    PhosphoSiteiQ53F39.

    Expressioni

    Tissue specificityi

    Expressed in brain.1 Publication

    Gene expression databases

    ArrayExpressiQ53F39.
    BgeeiQ53F39.
    GenevestigatoriQ53F39.

    Organism-specific databases

    HPAiHPA012639.

    Interactioni

    Subunit structurei

    Interacts with GPI-anchor proteins. Interacts with TMED10.1 Publication

    Protein-protein interaction databases

    BioGridi122415. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ53F39.
    SMRiQ53F39. Positions 70-161.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei27 – 4721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei356 – 37621HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi392 – 3965Di-lysine motif

    Domaini

    The di-lysine motif (KxKxx) acts as an endoplasmic reticulum retrieval signal.1 Publication

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG246417.
    HOVERGENiHBG101555.
    OMAiHSACEVH.
    OrthoDBiEOG722J8P.
    PhylomeDBiQ53F39.

    Family and domain databases

    Gene3Di3.60.21.10. 1 hit.
    InterProiIPR024654. Calcineurin-like_PHP_lpxH.
    IPR029052. Metallo-depent_PP-like.
    [Graphical view]
    PfamiPF12850. Metallophos_2. 1 hit.
    [Graphical view]
    SUPFAMiSSF56300. SSF56300. 1 hit.

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q53F39-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAMIELGFGR QNFHPLKRKS SLLLKLIAVV FAVLLFCEFL IYYLAIFQCN    50
    WPEVKTTASD GEQTTREPVL KAMFLADTHL LGEFLGHWLD KLRREWQMER 100
    AFQTALWLLQ PEVVFILGDI FDEGKWSTPE AWADDVERFQ KMFRHPSHVQ 150
    LKVVAGNHDI GFHYEMNTYK VERFEKVFSS ERLFSWKGIN FVMVNSVALN 200
    GDGCGICSET EAELIEVSHR LNCSREARGS SRCGPGPLLP TSAPVLLQHY 250
    PLYRRSDANC SGEDAAPAEE RDIPFKENYD VLSREASQKL LWWLQPRLVL 300
    SGHTHSACEV HHGGRVPELS VPSFSWRNRN NPSFIMGSIT PTDYTLSKCY 350
    LPREDVVLII YCGVVGFLVV LTLTHFGLLA SPFLSGLNLL GKRKTR 396
    Length:396
    Mass (Da):45,141
    Last modified:November 25, 2008 - v2
    Checksum:iD117BCDB1630560A
    GO
    Isoform 2 (identifier: Q53F39-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         338-396: SITPTDYTLSKCYLPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR → TDA

    Show »
    Length:340
    Mass (Da):38,933
    Checksum:i3F0B26CB0C48B354
    GO
    Isoform 3 (identifier: Q53F39-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         226-226: E → EQ
         338-396: SITPTDYTLSKCYLPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR → TDA

    Show »
    Length:341
    Mass (Da):39,061
    Checksum:i39DED2417CD4BBD4
    GO
    Isoform 4 (identifier: Q53F39-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         227-289: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:333
    Mass (Da):38,270
    Checksum:i6691B3999DC34E9E
    GO
    Isoform 5 (identifier: Q53F39-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         227-256: ARGSSRCGPGPLLPTSAPVLLQHYPLYRRS → VGEHLNATGAFCPVLLRFGCSLSPLALLAL
         257-396: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:256
    Mass (Da):29,351
    Checksum:i4BBDA145C3984B9D
    GO

    Sequence cautioni

    The sequence BAB14378.1 differs from that shown. Reason: Frameshift at position 201.
    The sequence BAB13863.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti22 – 221L → S in BAB14378. (PubMed:14702039)Curated
    Sequence conflicti32 – 321A → T in BAB14378. (PubMed:14702039)Curated
    Sequence conflicti97 – 971Q → R in AAL55744. (PubMed:15498874)Curated
    Sequence conflicti301 – 3011S → I in AAH73994. (PubMed:15489334)Curated
    Sequence conflicti364 – 3641V → E in AAM00279. (PubMed:11978971)Curated
    Sequence conflicti364 – 3641V → E in AAM00277. (PubMed:11978971)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti138 – 1381R → Q.
    Corresponds to variant rs11872520 [ dbSNP | Ensembl ].
    VAR_038294
    Natural varianti197 – 1971V → M.
    Corresponds to variant rs35611363 [ dbSNP | Ensembl ].
    VAR_038295
    Natural varianti268 – 2681A → P.4 Publications
    Corresponds to variant rs662515 [ dbSNP | Ensembl ].
    VAR_038296
    Natural varianti336 – 3361M → L.
    Corresponds to variant rs16976814 [ dbSNP | Ensembl ].
    VAR_038297

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei226 – 2261E → EQ in isoform 3. 1 PublicationVSP_030679
    Alternative sequencei227 – 28963Missing in isoform 4. 1 PublicationVSP_030680Add
    BLAST
    Alternative sequencei227 – 25630ARGSS…LYRRS → VGEHLNATGAFCPVLLRFGC SLSPLALLAL in isoform 5. 1 PublicationVSP_030681Add
    BLAST
    Alternative sequencei257 – 396140Missing in isoform 5. 1 PublicationVSP_030682Add
    BLAST
    Alternative sequencei338 – 39659SITPT…KRKTR → TDA in isoform 2 and isoform 3. 4 PublicationsVSP_030683Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF363483, AF363482 Genomic DNA. Translation: AAM00277.1.
    AF363483, AF363482 Genomic DNA. Translation: AAM00278.1.
    AF363484 mRNA. Translation: AAM00279.1.
    AK021647 mRNA. Translation: BAB13863.1. Different initiation.
    AK023052 mRNA. Translation: BAB14378.1. Frameshift.
    AK223450 mRNA. Translation: BAD97170.1.
    AF289560 mRNA. Translation: AAL55744.1.
    EF444996 Genomic DNA. Translation: ACA06017.1.
    EF444996 Genomic DNA. Translation: ACA06018.1.
    EF444996 Genomic DNA. Translation: ACA06019.1.
    AP001269 Genomic DNA. No translation available.
    CH471113 Genomic DNA. Translation: EAX01562.1.
    CH471113 Genomic DNA. Translation: EAX01565.1.
    CH471113 Genomic DNA. Translation: EAX01564.1.
    CH471113 Genomic DNA. Translation: EAX01569.1.
    CH471113 Genomic DNA. Translation: EAX01571.1.
    CH471113 Genomic DNA. Translation: EAX01567.1.
    CH471113 Genomic DNA. Translation: EAX01568.1.
    BC002877 mRNA. Translation: AAH02877.1.
    BC073994 mRNA. Translation: AAH73994.1.
    CCDSiCCDS11853.1. [Q53F39-1]
    CCDS56054.1. [Q53F39-4]
    RefSeqiNP_001229833.1. NM_001242904.1. [Q53F39-4]
    NP_075563.3. NM_023075.5. [Q53F39-1]
    XP_006722409.1. XM_006722346.1. [Q53F39-1]
    UniGeneiHs.712666.
    Hs.734268.

    Genome annotation databases

    EnsembliENST00000309976; ENSP00000311200; ENSG00000154889. [Q53F39-4]
    ENST00000317235; ENSP00000327257; ENSG00000154889. [Q53F39-4]
    ENST00000496196; ENSP00000433950; ENSG00000154889. [Q53F39-2]
    ENST00000588072; ENSP00000465894; ENSG00000154889. [Q53F39-1]
    GeneIDi65258.
    KEGGihsa:65258.
    UCSCiuc002kqf.3. human. [Q53F39-1]
    uc002kqm.3. human. [Q53F39-4]
    uc010dla.2. human. [Q53F39-3]

    Polymorphism databases

    DMDMi215274110.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF363483 , AF363482 Genomic DNA. Translation: AAM00277.1 .
    AF363483 , AF363482 Genomic DNA. Translation: AAM00278.1 .
    AF363484 mRNA. Translation: AAM00279.1 .
    AK021647 mRNA. Translation: BAB13863.1 . Different initiation.
    AK023052 mRNA. Translation: BAB14378.1 . Frameshift.
    AK223450 mRNA. Translation: BAD97170.1 .
    AF289560 mRNA. Translation: AAL55744.1 .
    EF444996 Genomic DNA. Translation: ACA06017.1 .
    EF444996 Genomic DNA. Translation: ACA06018.1 .
    EF444996 Genomic DNA. Translation: ACA06019.1 .
    AP001269 Genomic DNA. No translation available.
    CH471113 Genomic DNA. Translation: EAX01562.1 .
    CH471113 Genomic DNA. Translation: EAX01565.1 .
    CH471113 Genomic DNA. Translation: EAX01564.1 .
    CH471113 Genomic DNA. Translation: EAX01569.1 .
    CH471113 Genomic DNA. Translation: EAX01571.1 .
    CH471113 Genomic DNA. Translation: EAX01567.1 .
    CH471113 Genomic DNA. Translation: EAX01568.1 .
    BC002877 mRNA. Translation: AAH02877.1 .
    BC073994 mRNA. Translation: AAH73994.1 .
    CCDSi CCDS11853.1. [Q53F39-1 ]
    CCDS56054.1. [Q53F39-4 ]
    RefSeqi NP_001229833.1. NM_001242904.1. [Q53F39-4 ]
    NP_075563.3. NM_023075.5. [Q53F39-1 ]
    XP_006722409.1. XM_006722346.1. [Q53F39-1 ]
    UniGenei Hs.712666.
    Hs.734268.

    3D structure databases

    ProteinModelPortali Q53F39.
    SMRi Q53F39. Positions 70-161.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122415. 1 interaction.

    PTM databases

    PhosphoSitei Q53F39.

    Polymorphism databases

    DMDMi 215274110.

    Proteomic databases

    MaxQBi Q53F39.
    PaxDbi Q53F39.
    PRIDEi Q53F39.

    Protocols and materials databases

    DNASUi 65258.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000309976 ; ENSP00000311200 ; ENSG00000154889 . [Q53F39-4 ]
    ENST00000317235 ; ENSP00000327257 ; ENSG00000154889 . [Q53F39-4 ]
    ENST00000496196 ; ENSP00000433950 ; ENSG00000154889 . [Q53F39-2 ]
    ENST00000588072 ; ENSP00000465894 ; ENSG00000154889 . [Q53F39-1 ]
    GeneIDi 65258.
    KEGGi hsa:65258.
    UCSCi uc002kqf.3. human. [Q53F39-1 ]
    uc002kqm.3. human. [Q53F39-4 ]
    uc010dla.2. human. [Q53F39-3 ]

    Organism-specific databases

    CTDi 65258.
    GeneCardsi GC18M012841.
    H-InvDB HIX0014342.
    HGNCi HGNC:15988. MPPE1.
    HPAi HPA012639.
    MIMi 611900. gene.
    neXtProti NX_Q53F39.
    PharmGKBi PA134913534.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG246417.
    HOVERGENi HBG101555.
    OMAi HSACEVH.
    OrthoDBi EOG722J8P.
    PhylomeDBi Q53F39.

    Miscellaneous databases

    ChiTaRSi MPPE1. human.
    GenomeRNAii 65258.
    NextBioi 67378.
    PROi Q53F39.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q53F39.
    Bgeei Q53F39.
    Genevestigatori Q53F39.

    Family and domain databases

    Gene3Di 3.60.21.10. 1 hit.
    InterProi IPR024654. Calcineurin-like_PHP_lpxH.
    IPR029052. Metallo-depent_PP-like.
    [Graphical view ]
    Pfami PF12850. Metallophos_2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56300. SSF56300. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "cDNA cloning, genomic organization and expression of the novel human metallophosphoesterase gene MPPE1 on chromosome 18p11.2."
      Vuoristo J.T., Ala-Kokko L.
      Cytogenet. Cell Genet. 95:60-63(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 185-340 (ISOFORM 2), VARIANT PRO-268.
      Tissue: Embryo and Teratocarcinoma.
    3. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-268.
      Tissue: Dermoid cancer.
    4. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
      Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
      , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
      Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT PRO-268.
    5. NHLBI resequencing and genotyping service (RS&G)
      Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT PRO-268.
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
      Tissue: Lung and PNS.
    9. "GPI glycan remodeling by PGAP5 regulates transport of GPI-anchored proteins from the ER to the Golgi."
      Fujita M., Maeda Y., Ra M., Yamaguchi Y., Taguchi R., Kinoshita T.
      Cell 139:352-365(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, COFACTOR, DOMAIN DI-LYSINE MOTIF, SUBCELLULAR LOCATION, MUTAGENESIS OF ASP-77; HIS-79; ASP-119; ASN-157; HIS-158; HIS-249; HIS-303; HIS-305 AND 392-LYS--LYS-394, INTERACTION WITH GPI-ANCHOR PROTEINS AND TMED10.

    Entry informationi

    Entry nameiMPPE1_HUMAN
    AccessioniPrimary (citable) accession number: Q53F39
    Secondary accession number(s): B0YJ39
    , B0YJ40, B0YJ41, B5ME53, B7WNJ3, D3DUI5, D3DUI7, Q6GMP1, Q8TAD6, Q8TE26, Q8WZ32, Q9BU58, Q9H958, Q9HAI4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 15, 2008
    Last sequence update: November 25, 2008
    Last modified: October 1, 2014
    This is version 78 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 18
      Human chromosome 18: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3