Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Metallophosphoesterase 1

Gene

MPPE1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Metallophosphoesterase required for transport of GPI-anchor proteins from the endoplasmic reticulum to the Golgi. Acts in lipid remodeling steps of GPI-anchor maturation by mediating the removal of a side-chain ethanolamine-phosphate (EtNP) from the second Man (Man2) of the GPI intermediate, an essential step for efficient transport of GPI-anchor proteins.1 Publication

Cofactori

Mn2+1 PublicationNote: Binds 2 manganese ions per subunit.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi77 – 771Divalent metal cation 2Curated
Metal bindingi119 – 1191Divalent metal cation 1Curated
Metal bindingi119 – 1191Divalent metal cation 2Curated
Metal bindingi157 – 1571Divalent metal cation 1Curated
Metal bindingi249 – 2491Divalent metal cation 1Curated
Metal bindingi303 – 3031Divalent metal cation 1Curated
Metal bindingi305 – 3051Divalent metal cation 2Curated

GO - Molecular functioni

  1. GPI anchor binding Source: UniProtKB
  2. manganese ion binding Source: UniProtKB
  3. phosphoric diester hydrolase activity Source: UniProtKB

GO - Biological processi

  1. ER to Golgi vesicle-mediated transport Source: UniProtKB
  2. GPI anchor biosynthetic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

ER-Golgi transport, GPI-anchor biosynthesis, Transport

Keywords - Ligandi

Manganese, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Metallophosphoesterase 1 (EC:3.1.-.-)
Alternative name(s):
Post-GPI attachment to proteins factor 5
Gene namesi
Name:MPPE1
Synonyms:PGAP5
ORF Names:PP579
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 18

Organism-specific databases

HGNCiHGNC:15988. MPPE1.

Subcellular locationi

  1. Endoplasmic reticulum-Golgi intermediate compartment membrane 1 Publication; Multi-pass membrane protein 1 Publication
  2. Golgi apparatuscis-Golgi network membrane 1 Publication; Multi-pass membrane protein 1 Publication

  3. Note: Also localizes to endoplasmic reticulum exit site.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei27 – 4721HelicalSequence AnalysisAdd
BLAST
Transmembranei356 – 37621HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cis-Golgi network Source: UniProtKB
  2. endoplasmic reticulum exit site Source: UniProtKB
  3. endoplasmic reticulum-Golgi intermediate compartment Source: UniProtKB
  4. endoplasmic reticulum-Golgi intermediate compartment membrane Source: UniProtKB-SubCell
  5. Golgi apparatus Source: HPA
  6. integral component of membrane Source: UniProtKB-KW
  7. nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi77 – 771D → A: Affects transport of GPI-anchor proteins. 1 Publication
Mutagenesisi79 – 791H → A: Affects transport of GPI-anchor proteins. 1 Publication
Mutagenesisi119 – 1191D → A or N: Affects transport of GPI-anchor proteins. 1 Publication
Mutagenesisi157 – 1571N → A: Affects transport of GPI-anchor proteins. 1 Publication
Mutagenesisi158 – 1581H → A: Affects transport of GPI-anchor proteins. 1 Publication
Mutagenesisi249 – 2491H → A: Affects transport of GPI-anchor proteins. 1 Publication
Mutagenesisi303 – 3031H → A: Affects transport of GPI-anchor proteins. 1 Publication
Mutagenesisi305 – 3051H → A: Affects transport of GPI-anchor proteins. 1 Publication
Mutagenesisi392 – 3943KRK → ARA: Affects subcellular localization. 1 Publication

Organism-specific databases

PharmGKBiPA134913534.

Polymorphism and mutation databases

BioMutaiMPPE1.
DMDMi215274110.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 396396Metallophosphoesterase 1PRO_0000315727Add
BLAST

Proteomic databases

MaxQBiQ53F39.
PaxDbiQ53F39.
PRIDEiQ53F39.

PTM databases

PhosphoSiteiQ53F39.

Expressioni

Tissue specificityi

Expressed in brain.1 Publication

Gene expression databases

BgeeiQ53F39.
ExpressionAtlasiQ53F39. baseline and differential.
GenevestigatoriQ53F39.

Organism-specific databases

HPAiHPA012639.

Interactioni

Subunit structurei

Interacts with GPI-anchor proteins. Interacts with TMED10.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FLJ13057Q53SE73EBI-10242229,EBI-10172181
ZNF426Q9BUY53EBI-10242229,EBI-743265

Protein-protein interaction databases

BioGridi122415. 4 interactions.
IntActiQ53F39. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ53F39.
SMRiQ53F39. Positions 71-161.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi392 – 3965Di-lysine motif

Domaini

The di-lysine motif (KxKxx) acts as an endoplasmic reticulum retrieval signal.1 Publication

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG246417.
GeneTreeiENSGT00390000013236.
HOVERGENiHBG101555.
InParanoidiQ53F39.
OMAiLLFLAHC.
OrthoDBiEOG722J8P.
PhylomeDBiQ53F39.

Family and domain databases

Gene3Di3.60.21.10. 1 hit.
InterProiIPR024654. Calcineurin-like_PHP_lpxH.
IPR029052. Metallo-depent_PP-like.
[Graphical view]
PfamiPF12850. Metallophos_2. 1 hit.
[Graphical view]
SUPFAMiSSF56300. SSF56300. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q53F39-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAMIELGFGR QNFHPLKRKS SLLLKLIAVV FAVLLFCEFL IYYLAIFQCN
60 70 80 90 100
WPEVKTTASD GEQTTREPVL KAMFLADTHL LGEFLGHWLD KLRREWQMER
110 120 130 140 150
AFQTALWLLQ PEVVFILGDI FDEGKWSTPE AWADDVERFQ KMFRHPSHVQ
160 170 180 190 200
LKVVAGNHDI GFHYEMNTYK VERFEKVFSS ERLFSWKGIN FVMVNSVALN
210 220 230 240 250
GDGCGICSET EAELIEVSHR LNCSREARGS SRCGPGPLLP TSAPVLLQHY
260 270 280 290 300
PLYRRSDANC SGEDAAPAEE RDIPFKENYD VLSREASQKL LWWLQPRLVL
310 320 330 340 350
SGHTHSACEV HHGGRVPELS VPSFSWRNRN NPSFIMGSIT PTDYTLSKCY
360 370 380 390
LPREDVVLII YCGVVGFLVV LTLTHFGLLA SPFLSGLNLL GKRKTR
Length:396
Mass (Da):45,141
Last modified:November 25, 2008 - v2
Checksum:iD117BCDB1630560A
GO
Isoform 2 (identifier: Q53F39-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     338-396: SITPTDYTLSKCYLPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR → TDA

Show »
Length:340
Mass (Da):38,933
Checksum:i3F0B26CB0C48B354
GO
Isoform 3 (identifier: Q53F39-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     226-226: E → EQ
     338-396: SITPTDYTLSKCYLPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR → TDA

Show »
Length:341
Mass (Da):39,061
Checksum:i39DED2417CD4BBD4
GO
Isoform 4 (identifier: Q53F39-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-289: Missing.

Note: No experimental confirmation available.

Show »
Length:333
Mass (Da):38,270
Checksum:i6691B3999DC34E9E
GO
Isoform 5 (identifier: Q53F39-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-256: ARGSSRCGPGPLLPTSAPVLLQHYPLYRRS → VGEHLNATGAFCPVLLRFGCSLSPLALLAL
     257-396: Missing.

Note: No experimental confirmation available.

Show »
Length:256
Mass (Da):29,351
Checksum:i4BBDA145C3984B9D
GO

Sequence cautioni

The sequence BAB13863.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB14378.1 differs from that shown. Reason: Frameshift at position 201. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti22 – 221L → S in BAB14378 (PubMed:14702039).Curated
Sequence conflicti32 – 321A → T in BAB14378 (PubMed:14702039).Curated
Sequence conflicti97 – 971Q → R in AAL55744 (PubMed:15498874).Curated
Sequence conflicti301 – 3011S → I in AAH73994 (PubMed:15489334).Curated
Sequence conflicti364 – 3641V → E in AAM00279 (PubMed:11978971).Curated
Sequence conflicti364 – 3641V → E in AAM00277 (PubMed:11978971).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti138 – 1381R → Q.
Corresponds to variant rs11872520 [ dbSNP | Ensembl ].
VAR_038294
Natural varianti197 – 1971V → M.
Corresponds to variant rs35611363 [ dbSNP | Ensembl ].
VAR_038295
Natural varianti268 – 2681A → P.4 Publications
Corresponds to variant rs662515 [ dbSNP | Ensembl ].
VAR_038296
Natural varianti336 – 3361M → L.
Corresponds to variant rs16976814 [ dbSNP | Ensembl ].
VAR_038297

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei226 – 2261E → EQ in isoform 3. 1 PublicationVSP_030679
Alternative sequencei227 – 28963Missing in isoform 4. 1 PublicationVSP_030680Add
BLAST
Alternative sequencei227 – 25630ARGSS…LYRRS → VGEHLNATGAFCPVLLRFGC SLSPLALLAL in isoform 5. 1 PublicationVSP_030681Add
BLAST
Alternative sequencei257 – 396140Missing in isoform 5. 1 PublicationVSP_030682Add
BLAST
Alternative sequencei338 – 39659SITPT…KRKTR → TDA in isoform 2 and isoform 3. 4 PublicationsVSP_030683Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF363483, AF363482 Genomic DNA. Translation: AAM00277.1.
AF363483, AF363482 Genomic DNA. Translation: AAM00278.1.
AF363484 mRNA. Translation: AAM00279.1.
AK021647 mRNA. Translation: BAB13863.1. Different initiation.
AK023052 mRNA. Translation: BAB14378.1. Frameshift.
AK223450 mRNA. Translation: BAD97170.1.
AF289560 mRNA. Translation: AAL55744.1.
EF444996 Genomic DNA. Translation: ACA06017.1.
EF444996 Genomic DNA. Translation: ACA06018.1.
EF444996 Genomic DNA. Translation: ACA06019.1.
AP001269 Genomic DNA. No translation available.
CH471113 Genomic DNA. Translation: EAX01562.1.
CH471113 Genomic DNA. Translation: EAX01565.1.
CH471113 Genomic DNA. Translation: EAX01564.1.
CH471113 Genomic DNA. Translation: EAX01569.1.
CH471113 Genomic DNA. Translation: EAX01571.1.
CH471113 Genomic DNA. Translation: EAX01567.1.
CH471113 Genomic DNA. Translation: EAX01568.1.
BC002877 mRNA. Translation: AAH02877.1.
BC073994 mRNA. Translation: AAH73994.1.
CCDSiCCDS11853.1. [Q53F39-1]
CCDS56054.1. [Q53F39-4]
RefSeqiNP_001229833.1. NM_001242904.1. [Q53F39-4]
NP_075563.3. NM_023075.5. [Q53F39-1]
XP_006722409.1. XM_006722346.1. [Q53F39-1]
UniGeneiHs.712666.
Hs.734268.

Genome annotation databases

EnsembliENST00000309976; ENSP00000311200; ENSG00000154889. [Q53F39-4]
ENST00000317235; ENSP00000327257; ENSG00000154889. [Q53F39-4]
ENST00000496196; ENSP00000433950; ENSG00000154889. [Q53F39-2]
ENST00000588072; ENSP00000465894; ENSG00000154889. [Q53F39-1]
GeneIDi65258.
KEGGihsa:65258.
UCSCiuc002kqf.3. human. [Q53F39-1]
uc002kqm.3. human. [Q53F39-4]
uc010dla.2. human. [Q53F39-3]

Polymorphism and mutation databases

BioMutaiMPPE1.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF363483, AF363482 Genomic DNA. Translation: AAM00277.1.
AF363483, AF363482 Genomic DNA. Translation: AAM00278.1.
AF363484 mRNA. Translation: AAM00279.1.
AK021647 mRNA. Translation: BAB13863.1. Different initiation.
AK023052 mRNA. Translation: BAB14378.1. Frameshift.
AK223450 mRNA. Translation: BAD97170.1.
AF289560 mRNA. Translation: AAL55744.1.
EF444996 Genomic DNA. Translation: ACA06017.1.
EF444996 Genomic DNA. Translation: ACA06018.1.
EF444996 Genomic DNA. Translation: ACA06019.1.
AP001269 Genomic DNA. No translation available.
CH471113 Genomic DNA. Translation: EAX01562.1.
CH471113 Genomic DNA. Translation: EAX01565.1.
CH471113 Genomic DNA. Translation: EAX01564.1.
CH471113 Genomic DNA. Translation: EAX01569.1.
CH471113 Genomic DNA. Translation: EAX01571.1.
CH471113 Genomic DNA. Translation: EAX01567.1.
CH471113 Genomic DNA. Translation: EAX01568.1.
BC002877 mRNA. Translation: AAH02877.1.
BC073994 mRNA. Translation: AAH73994.1.
CCDSiCCDS11853.1. [Q53F39-1]
CCDS56054.1. [Q53F39-4]
RefSeqiNP_001229833.1. NM_001242904.1. [Q53F39-4]
NP_075563.3. NM_023075.5. [Q53F39-1]
XP_006722409.1. XM_006722346.1. [Q53F39-1]
UniGeneiHs.712666.
Hs.734268.

3D structure databases

ProteinModelPortaliQ53F39.
SMRiQ53F39. Positions 71-161.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122415. 4 interactions.
IntActiQ53F39. 2 interactions.

PTM databases

PhosphoSiteiQ53F39.

Polymorphism and mutation databases

BioMutaiMPPE1.
DMDMi215274110.

Proteomic databases

MaxQBiQ53F39.
PaxDbiQ53F39.
PRIDEiQ53F39.

Protocols and materials databases

DNASUi65258.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000309976; ENSP00000311200; ENSG00000154889. [Q53F39-4]
ENST00000317235; ENSP00000327257; ENSG00000154889. [Q53F39-4]
ENST00000496196; ENSP00000433950; ENSG00000154889. [Q53F39-2]
ENST00000588072; ENSP00000465894; ENSG00000154889. [Q53F39-1]
GeneIDi65258.
KEGGihsa:65258.
UCSCiuc002kqf.3. human. [Q53F39-1]
uc002kqm.3. human. [Q53F39-4]
uc010dla.2. human. [Q53F39-3]

Organism-specific databases

CTDi65258.
GeneCardsiGC18M013241.
H-InvDBHIX0014342.
HGNCiHGNC:15988. MPPE1.
HPAiHPA012639.
MIMi611900. gene.
neXtProtiNX_Q53F39.
PharmGKBiPA134913534.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG246417.
GeneTreeiENSGT00390000013236.
HOVERGENiHBG101555.
InParanoidiQ53F39.
OMAiLLFLAHC.
OrthoDBiEOG722J8P.
PhylomeDBiQ53F39.

Miscellaneous databases

ChiTaRSiMPPE1. human.
GenomeRNAii65258.
NextBioi67378.
PROiQ53F39.
SOURCEiSearch...

Gene expression databases

BgeeiQ53F39.
ExpressionAtlasiQ53F39. baseline and differential.
GenevestigatoriQ53F39.

Family and domain databases

Gene3Di3.60.21.10. 1 hit.
InterProiIPR024654. Calcineurin-like_PHP_lpxH.
IPR029052. Metallo-depent_PP-like.
[Graphical view]
PfamiPF12850. Metallophos_2. 1 hit.
[Graphical view]
SUPFAMiSSF56300. SSF56300. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "cDNA cloning, genomic organization and expression of the novel human metallophosphoesterase gene MPPE1 on chromosome 18p11.2."
    Vuoristo J.T., Ala-Kokko L.
    Cytogenet. Cell Genet. 95:60-63(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 185-340 (ISOFORM 2), VARIANT PRO-268.
    Tissue: Embryo and Teratocarcinoma.
  3. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-268.
    Tissue: Dermoid cancer.
  4. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT PRO-268.
  5. NHLBI resequencing and genotyping service (RS&G)
    Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT PRO-268.
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Lung and PNS.
  9. "GPI glycan remodeling by PGAP5 regulates transport of GPI-anchored proteins from the ER to the Golgi."
    Fujita M., Maeda Y., Ra M., Yamaguchi Y., Taguchi R., Kinoshita T.
    Cell 139:352-365(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, COFACTOR, DOMAIN DI-LYSINE MOTIF, SUBCELLULAR LOCATION, MUTAGENESIS OF ASP-77; HIS-79; ASP-119; ASN-157; HIS-158; HIS-249; HIS-303; HIS-305 AND 392-LYS--LYS-394, INTERACTION WITH GPI-ANCHOR PROTEINS AND TMED10.

Entry informationi

Entry nameiMPPE1_HUMAN
AccessioniPrimary (citable) accession number: Q53F39
Secondary accession number(s): B0YJ39
, B0YJ40, B0YJ41, B5ME53, B7WNJ3, D3DUI5, D3DUI7, Q6GMP1, Q8TAD6, Q8TE26, Q8WZ32, Q9BU58, Q9H958, Q9HAI4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: November 25, 2008
Last modified: April 29, 2015
This is version 83 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.