Q53F39 (MPPE1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 65.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Metallophosphoesterase 1 EC=3.1.-.- Alternative name(s): Post-GPI attachment to proteins factor 5 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 396 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Metallophosphoesterase required for transport of GPI-anchor proteins from the endoplasmic reticulum to the Golgi. Acts in lipid remodeling steps of GPI-anchor maturation by mediating the removal of a side-chain ethanolamine-phosphate (EtNP) from the second Man (Man2) of the GPI intermediate, an essential step for efficient transport of GPI-anchor proteins. Ref.9 |
| Cofactor | Binds 2 manganese ions per subunit Probable. Ref.9 |
| Subunit structure | Interacts with GPI-anchor proteins. Interacts with TMED10. Ref.9 |
| Subcellular location | Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Golgi apparatus › cis-Golgi network membrane; Multi-pass membrane protein. Note: Also localizes to endoplasmic reticulum exit site. Ref.9 |
| Tissue specificity | Expressed in brain. Ref.1 |
| Domain | The di-lysine motif (KxKxx) acts as an endoplasmic reticulum retrieval signal. Ref.9 |
| Sequence similarities | Belongs to the metallophosphoesterase superfamily. MPPE1 family. |
| Sequence caution | The sequence BAB13863.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB14378.1 differs from that shown. Reason: Frameshift at position 201. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q53F39-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q53F39-2) The sequence of this isoform differs from the canonical sequence as follows: 338-396: SITPTDYTLSKCYLPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR → TDA | ||||||
| Isoform 3 (identifier: Q53F39-3) The sequence of this isoform differs from the canonical sequence as follows: 226-226: E → EQ 338-396: SITPTDYTLSKCYLPREDVVLIIYCGVVGFLVVLTLTHFGLLASPFLSGLNLLGKRKTR → TDA | ||||||
| Isoform 4 (identifier: Q53F39-4) The sequence of this isoform differs from the canonical sequence as follows: 227-289: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q53F39-5) The sequence of this isoform differs from the canonical sequence as follows: 227-256: ARGSSRCGPGPLLPTSAPVLLQHYPLYRRS → VGEHLNATGAFCPVLLRFGCSLSPLALLAL 257-396: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 396 | 396 | Metallophosphoesterase 1 | PRO_0000315727 | |||||
Regions | |||||||||
| Transmembrane | 27 – 47 | 21 | Helical; Potential | ||||||
| Transmembrane | 356 – 376 | 21 | Helical; Potential | ||||||
| Motif | 392 – 396 | 5 | Di-lysine motif | ||||||
Sites | |||||||||
| Metal binding | 77 | 1 | Divalent metal cation 2 Probable | ||||||
| Metal binding | 119 | 1 | Divalent metal cation 1 Probable | ||||||
| Metal binding | 119 | 1 | Divalent metal cation 2 Probable | ||||||
| Metal binding | 157 | 1 | Divalent metal cation 1 Probable | ||||||
| Metal binding | 249 | 1 | Divalent metal cation 1 Probable | ||||||
| Metal binding | 303 | 1 | Divalent metal cation 1 Probable | ||||||
| Metal binding | 305 | 1 | Divalent metal cation 2 Probable | ||||||
Natural variations | |||||||||
| Alternative sequence | 226 | 1 | E → EQ in isoform 3. | VSP_030679 | |||||
| Alternative sequence | 227 – 289 | 63 | Missing in isoform 4. | VSP_030680 | |||||
| Alternative sequence | 227 – 256 | 30 | ARGSS…LYRRS → VGEHLNATGAFCPVLLRFGC SLSPLALLAL in isoform 5. | VSP_030681 | |||||
| Alternative sequence | 257 – 396 | 140 | Missing in isoform 5. | VSP_030682 | |||||
| Alternative sequence | 338 – 396 | 59 | SITPT…KRKTR → TDA in isoform 2 and isoform 3. | VSP_030683 | |||||
| Natural variant | 138 | 1 | R → Q. Corresponds to variant rs11872520 [ dbSNP | Ensembl ]. | VAR_038294 | |||||
| Natural variant | 197 | 1 | V → M. Corresponds to variant rs35611363 [ dbSNP | Ensembl ]. | VAR_038295 | |||||
| Natural variant | 268 | 1 | A → P. Ref.2 Ref.3 Ref.4 Ref.7 Corresponds to variant rs662515 [ dbSNP | Ensembl ]. | VAR_038296 | |||||
| Natural variant | 336 | 1 | M → L. Corresponds to variant rs16976814 [ dbSNP | Ensembl ]. | VAR_038297 | |||||
Experimental info | |||||||||
| Mutagenesis | 77 | 1 | D → A: Affects transport of GPI-anchor proteins. Ref.9 | ||||||
| Mutagenesis | 79 | 1 | H → A: Affects transport of GPI-anchor proteins. Ref.9 | ||||||
| Mutagenesis | 119 | 1 | D → A or N: Affects transport of GPI-anchor proteins. Ref.9 | ||||||
| Mutagenesis | 157 | 1 | N → A: Affects transport of GPI-anchor proteins. Ref.9 | ||||||
| Mutagenesis | 158 | 1 | H → A: Affects transport of GPI-anchor proteins. Ref.9 | ||||||
| Mutagenesis | 249 | 1 | H → A: Affects transport of GPI-anchor proteins. Ref.9 | ||||||
| Mutagenesis | 303 | 1 | H → A: Affects transport of GPI-anchor proteins. Ref.9 | ||||||
| Mutagenesis | 305 | 1 | H → A: Affects transport of GPI-anchor proteins. Ref.9 | ||||||
| Mutagenesis | 392 – 394 | 3 | KRK → ARA: Affects subcellular localization. Ref.9 | ||||||
| Sequence conflict | 22 | 1 | L → S in BAB14378. Ref.2 | ||||||
| Sequence conflict | 32 | 1 | A → T in BAB14378. Ref.2 | ||||||
| Sequence conflict | 97 | 1 | Q → R in AAL55744. Ref.4 | ||||||
| Sequence conflict | 301 | 1 | S → I in AAH73994. Ref.8 | ||||||
| Sequence conflict | 364 | 1 | V → E in AAM00279. Ref.1 | ||||||
| Sequence conflict | 364 | 1 | V → E in AAM00277. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning, genomic organization and expression of the novel human metallophosphoesterase gene MPPE1 on chromosome 18p11.2." Vuoristo J.T., Ala-Kokko L. Cytogenet. Cell Genet. 95:60-63(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 185-340 (ISOFORM 2), VARIANT PRO-268. Tissue: Embryo and Teratocarcinoma. |
| [3] | Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-268. Tissue: Dermoid cancer. |
| [4] | "Large-scale cDNA transfection screening for genes related to cancer development and progression." Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. Gu J.Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT PRO-268. |
| [5] | NHLBI resequencing and genotyping service (RS&G) Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [6] | "DNA sequence and analysis of human chromosome 18." Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J. Lander E.S.Nature 437:551-555(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT PRO-268. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Lung and PNS. |
| [9] | "GPI glycan remodeling by PGAP5 regulates transport of GPI-anchored proteins from the ER to the Golgi." Fujita M., Maeda Y., Ra M., Yamaguchi Y., Taguchi R., Kinoshita T. Cell 139:352-365(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, COFACTOR, DOMAIN DI-LYSINE MOTIF, SUBCELLULAR LOCATION, MUTAGENESIS OF ASP-77; HIS-79; ASP-119; ASN-157; HIS-158; HIS-249; HIS-303; HIS-305 AND 392-LYS--LYS-394, INTERACTION WITH GPI-ANCHOR PROTEINS AND TMED10. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF363483, AF363482 Genomic DNA. Translation: AAM00277.1. AF363483, AF363482 Genomic DNA. Translation: AAM00278.1. AF363484 mRNA. Translation: AAM00279.1. AK021647 mRNA. Translation: BAB13863.1. Different initiation. AK023052 mRNA. Translation: BAB14378.1. Frameshift. AK223450 mRNA. Translation: BAD97170.1. AF289560 mRNA. Translation: AAL55744.1. EF444996 Genomic DNA. Translation: ACA06017.1. EF444996 Genomic DNA. Translation: ACA06018.1. EF444996 Genomic DNA. Translation: ACA06019.1. AP001269 Genomic DNA. No translation available. CH471113 Genomic DNA. Translation: EAX01562.1. CH471113 Genomic DNA. Translation: EAX01565.1. CH471113 Genomic DNA. Translation: EAX01564.1. CH471113 Genomic DNA. Translation: EAX01569.1. CH471113 Genomic DNA. Translation: EAX01571.1. CH471113 Genomic DNA. Translation: EAX01567.1. CH471113 Genomic DNA. Translation: EAX01568.1. BC002877 mRNA. Translation: AAH02877.1. BC073994 mRNA. Translation: AAH73994.1. |
| IPI | IPI00042492. IPI00789564. IPI00878898. IPI00914979. IPI00977155. |
| RefSeq | NP_001229833.1. NM_001242904.1. NP_075563.3. NM_023075.5. |
| UniGene | Hs.136295. Hs.712666. Hs.734268. |
3D structure databases | |
| ProteinModelPortal | Q53F39. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q53F39. |
Polymorphism databases | |
| DMDM | 215274110. |
Proteomic databases | |
| PaxDb | Q53F39. |
| PRIDE | Q53F39. |
Protocols and materials databases | |
| DNASU | 65258. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000309976; ENSP00000311200; ENSG00000154889. ENST00000317235; ENSP00000327257; ENSG00000154889. ENST00000399978; ENSP00000382860; ENSG00000154889. ENST00000496196; ENSP00000433950; ENSG00000154889. ENST00000588072; ENSP00000465894; ENSG00000154889. |
| GeneID | 65258. |
| KEGG | hsa:65258. |
| UCSC | uc002kqf.3. human. uc002kqm.3. human. uc010dla.2. human. |
Organism-specific databases | |
| CTD | 65258. |
| GeneCards | GC18M011883. |
| H-InvDB | HIX0014342. |
| HGNC | HGNC:15988. MPPE1. |
| HPA | HPA012639. |
| MIM | 611900. gene. |
| neXtProt | NX_Q53F39. |
| PharmGKB | PA134913534. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG246417. |
| HOVERGEN | HBG101555. |
| OrthoDB | EOG46Q6SX. |
| PhylomeDB | Q53F39. |
Gene expression databases | |
| Bgee | Q53F39. |
| Genevestigator | Q53F39. |
Family and domain databases | |
| InterPro | IPR024654. Calcineurin-like_PEstase_dom. [Graphical view] |
| Pfam | PF12850. Metallophos_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MPPE1. human. |
| GenomeRNAi | 65258. |
| NextBio | 67378. |
| SOURCE | Search... |
Entry information
| Entry name | MPPE1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q53F39 Secondary accession number(s): B0YJ39 Q9HAI4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
