Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM98B

Gene

FAM98B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-6784531. tRNA processing in the nucleus.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM98B
Gene namesi
Name:FAM98B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:26773. FAM98B.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • nucleoplasm Source: Reactome
  • nucleus Source: UniProtKB
  • tRNA-splicing ligase complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671778.

Polymorphism and mutation databases

DMDMi74735811.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 330330Protein FAM98BPRO_0000187188Add
BLAST

Proteomic databases

EPDiQ52LJ0.
MaxQBiQ52LJ0.
PaxDbiQ52LJ0.
PRIDEiQ52LJ0.

PTM databases

iPTMnetiQ52LJ0.
PhosphoSiteiQ52LJ0.

Expressioni

Gene expression databases

BgeeiQ52LJ0.
CleanExiHS_FAM98B.
ExpressionAtlasiQ52LJ0. baseline and differential.
GenevisibleiQ52LJ0. HS.

Organism-specific databases

HPAiHPA008320.
HPA008502.

Interactioni

Subunit structurei

Component of the tRNA-splicing ligase complex.2 Publications

Protein-protein interaction databases

BioGridi129661. 30 interactions.
DIPiDIP-50585N.
IntActiQ52LJ0. 3 interactions.
MINTiMINT-4826469.
STRINGi9606.ENSP00000380734.

Structurei

3D structure databases

ProteinModelPortaliQ52LJ0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM98 family.Curated

Phylogenomic databases

eggNOGiKOG3973. Eukaryota.
ENOG4111GTB. LUCA.
GeneTreeiENSGT00440000037341.
HOGENOMiHOG000231951.
HOVERGENiHBG054060.
InParanoidiQ52LJ0.
KOiK15434.
OMAiWNPQGGR.
OrthoDBiEOG7BKCV2.
PhylomeDBiQ52LJ0.
TreeFamiTF320308.

Family and domain databases

InterProiIPR018797. Uncharacterised_FAM98.
[Graphical view]
PfamiPF10239. DUF2465. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q52LJ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRGPEPGPQP TMEGDVLDTL EALGYKGPLL EEQALTKAAE GGLSSPEFSE
60 70 80 90 100
LCIWLGSQIK SLCNLEESIT SAGRDDLESF QLEISGFLKE MACPYSVLIS
110 120 130 140 150
GDIKDRLKKK EDCLKLLLFL STELQASQIL QNKKHKNSQL DKNSEVYQEV
160 170 180 190 200
QAMFDTLGIP KSTTSDIPHM LNQVESKVKD ILSKVQKNHV GKPLLKMDLN
210 220 230 240 250
SEQAEQLERI NDALSCEYEC RRRMLMKRLD VTVQSFGWSD RAKVKTDDIA
260 270 280 290 300
RIYQPKRYAL SPKTTITMAH LLAAREDLSK IIRTSSGTSR EKTACAINKV
310 320 330
GVSFSTVENE LMISYLMFLQ ILVYFSFMSW
Length:330
Mass (Da):37,191
Last modified:May 24, 2005 - v1
Checksum:iC56C3C230B99A35E
GO
Isoform 2 (identifier: Q52LJ0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     301-330: GVSFSTVENELMISYLMFLQILVYFSFMSW → LMGRVPDRGG...GGGGGGYRRY

Note: No experimental confirmation available.
Show »
Length:433
Mass (Da):45,547
Checksum:i4A46D5F04FAB2530
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti22 – 221A → T in BAC04621 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei301 – 33030GVSFS…SFMSW → LMGRVPDRGGRPNEIEPPPP EMPPWQKRQEGGGGRGGWGG GGGGGGRGGGGGGGGRGGWG GGGGGWGGGGGGGGGWGGGG GGGRGGFQGRGDYGGRGGYG GRGGYGGRGYGDPYGGGGGG GGGGGGGGGYRRY in isoform 2. CuratedVSP_045170Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK095745 mRNA. Translation: BAC04621.1.
AC109631 Genomic DNA. No translation available.
AC116158 Genomic DNA. No translation available.
BC093898 mRNA. Translation: AAH93898.1.
CCDSiCCDS10047.2. [Q52LJ0-2]
RefSeqiNP_775882.2. NM_173611.3. [Q52LJ0-2]
UniGeneiHs.625289.
Hs.6799.
Hs.744003.

Genome annotation databases

EnsembliENST00000397609; ENSP00000380734; ENSG00000171262. [Q52LJ0-2]
ENST00000491535; ENSP00000453166; ENSG00000171262. [Q52LJ0-1]
GeneIDi283742.
KEGGihsa:283742.
UCSCiuc001zkb.3. human. [Q52LJ0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK095745 mRNA. Translation: BAC04621.1.
AC109631 Genomic DNA. No translation available.
AC116158 Genomic DNA. No translation available.
BC093898 mRNA. Translation: AAH93898.1.
CCDSiCCDS10047.2. [Q52LJ0-2]
RefSeqiNP_775882.2. NM_173611.3. [Q52LJ0-2]
UniGeneiHs.625289.
Hs.6799.
Hs.744003.

3D structure databases

ProteinModelPortaliQ52LJ0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129661. 30 interactions.
DIPiDIP-50585N.
IntActiQ52LJ0. 3 interactions.
MINTiMINT-4826469.
STRINGi9606.ENSP00000380734.

PTM databases

iPTMnetiQ52LJ0.
PhosphoSiteiQ52LJ0.

Polymorphism and mutation databases

DMDMi74735811.

Proteomic databases

EPDiQ52LJ0.
MaxQBiQ52LJ0.
PaxDbiQ52LJ0.
PRIDEiQ52LJ0.

Protocols and materials databases

DNASUi283742.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000397609; ENSP00000380734; ENSG00000171262. [Q52LJ0-2]
ENST00000491535; ENSP00000453166; ENSG00000171262. [Q52LJ0-1]
GeneIDi283742.
KEGGihsa:283742.
UCSCiuc001zkb.3. human. [Q52LJ0-1]

Organism-specific databases

CTDi283742.
GeneCardsiFAM98B.
HGNCiHGNC:26773. FAM98B.
HPAiHPA008320.
HPA008502.
MIMi616142. gene.
neXtProtiNX_Q52LJ0.
PharmGKBiPA142671778.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3973. Eukaryota.
ENOG4111GTB. LUCA.
GeneTreeiENSGT00440000037341.
HOGENOMiHOG000231951.
HOVERGENiHBG054060.
InParanoidiQ52LJ0.
KOiK15434.
OMAiWNPQGGR.
OrthoDBiEOG7BKCV2.
PhylomeDBiQ52LJ0.
TreeFamiTF320308.

Enzyme and pathway databases

ReactomeiR-HSA-6784531. tRNA processing in the nucleus.

Miscellaneous databases

ChiTaRSiFAM98B. human.
GenomeRNAii283742.
NextBioi94206.
PROiQ52LJ0.
SOURCEiSearch...

Gene expression databases

BgeeiQ52LJ0.
CleanExiHS_FAM98B.
ExpressionAtlasiQ52LJ0. baseline and differential.
GenevisibleiQ52LJ0. HS.

Family and domain databases

InterProiIPR018797. Uncharacterised_FAM98.
[Graphical view]
PfamiPF10239. DUF2465. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  5. Cited for: IDENTIFICATION IN THE TRNA SPLICING LIGASE COMPLEX.
  6. "Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors."
    Popow J., Jurkin J., Schleiffer A., Martinez J.
    Nature 511:104-107(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE TRNA SPLICING LIGASE COMPLEX.
  7. "hCLE/C14orf166 associates with DDX1-HSPC117-FAM98B in a novel transcription-dependent shuttling RNA-transporting complex."
    Perez-Gonzalez A., Pazo A., Navajas R., Ciordia S., Rodriguez-Frandsen A., Nieto A.
    PLoS ONE 9:E90957-E90957(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiFA98B_HUMAN
AccessioniPrimary (citable) accession number: Q52LJ0
Secondary accession number(s): A8MUW5, Q8N935
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: May 24, 2005
Last modified: May 11, 2016
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.