Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/arginine repetitive matrix protein 1

Gene

Srrm1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Part of pre- and post-splicing multiprotein mRNP complexes. Involved in numerous pre-mRNA processing events. Promotes constitutive and exonic splicing enhancer (ESE)-dependent splicing activation by bridging together sequence-specific (SR family proteins, SFRS4, SFRS5 and TRA2B/SFRS10) and basal snRNP (SNRP70 and SNRPA1) factors of the spliceosome. Stimulates mRNA 3'-end cleavage independently of the formation of an exon junction complex. Binds both pre-mRNA and spliced mRNA 20-25 nt upstream of exon-exon junctions. Binds RNA and DNA with low sequence specificity and has similar preference for either double- or single-stranded nucleic acid substrates (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

mRNA processing, mRNA splicing

Keywords - Ligandi

DNA-binding, RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/arginine repetitive matrix protein 1
Alternative name(s):
Plenty-of-prolines 101
Gene namesi
Name:Srrm1
Synonyms:Pop101
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1858303. Srrm1.

Subcellular locationi

  • Nucleus matrix PROSITE-ProRule annotation
  • Nucleus speckle PROSITE-ProRule annotation

GO - Cellular componenti

  • nuclear matrix Source: MGI
  • nuclear speck Source: UniProtKB-SubCell
  • spliceosomal complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Nucleus, Spliceosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000763271 – 946Serine/arginine repetitive matrix protein 1Add BLAST946

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei7Citrulline1 Publication1
Modified residuei140N6-acetyllysineCombined sources1
Modified residuei220PhosphoserineCombined sources1
Modified residuei227PhosphoserineBy similarity1
Cross-linki231Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)By similarity
Modified residuei234PhosphoserineBy similarity1
Modified residuei240PhosphoserineBy similarity1
Modified residuei241PhosphothreonineBy similarity1
Cross-linki249Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei260PhosphoserineCombined sources1
Modified residuei387PhosphoserineBy similarity1
Modified residuei389PhosphoserineBy similarity1
Modified residuei391PhosphoserineCombined sources1
Modified residuei400PhosphoserineBy similarity1
Modified residuei404PhosphothreonineBy similarity1
Modified residuei412PhosphoserineBy similarity1
Modified residuei414PhosphothreonineBy similarity1
Modified residuei418PhosphoserineBy similarity1
Modified residuei427PhosphoserineCombined sources1
Modified residuei429PhosphoserineCombined sources1
Modified residuei434PhosphoserineBy similarity1
Modified residuei448PhosphoserineBy similarity1
Modified residuei450PhosphoserineBy similarity1
Modified residuei461PhosphoserineBy similarity1
Modified residuei463PhosphoserineBy similarity1
Modified residuei476PhosphoserineBy similarity1
Modified residuei522PhosphoserineBy similarity1
Modified residuei524PhosphoserineBy similarity1
Modified residuei526PhosphoserineBy similarity1
Modified residuei528PhosphoserineBy similarity1
Modified residuei530PhosphoserineBy similarity1
Modified residuei561PhosphoserineBy similarity1
Modified residuei563PhosphoserineBy similarity1
Modified residuei572PhosphoserineCombined sources1
Modified residuei574PhosphoserineCombined sources1
Modified residuei593PhosphothreonineBy similarity1
Modified residuei600PhosphothreonineBy similarity1
Modified residuei602PhosphoserineBy similarity1
Modified residuei615PhosphotyrosineBy similarity1
Modified residuei616PhosphoserineCombined sources1
Modified residuei624PhosphoserineBy similarity1
Modified residuei626PhosphoserineBy similarity1
Modified residuei633PhosphothreonineCombined sources1
Modified residuei635PhosphoserineCombined sources1
Modified residuei645PhosphoserineBy similarity1
Modified residuei647PhosphoserineBy similarity1
Modified residuei655PhosphoserineBy similarity1
Modified residuei657PhosphoserineCombined sources1
Modified residuei713PhosphoserineCombined sources1
Modified residuei714PhosphoserineCombined sources1
Modified residuei723PhosphoserineCombined sources1
Modified residuei725PhosphoserineCombined sources1
Modified residuei731PhosphoserineCombined sources1
Modified residuei733PhosphoserineCombined sources1
Modified residuei736PhosphothreonineBy similarity1
Modified residuei779PhosphoserineCombined sources1
Modified residuei781PhosphoserineBy similarity1
Modified residuei789PhosphoserineBy similarity1
Modified residuei793PhosphoserineBy similarity1
Modified residuei795PhosphoserineCombined sources1
Modified residuei797PhosphoserineCombined sources1
Modified residuei810PhosphoserineCombined sources1
Modified residuei814PhosphoserineCombined sources1
Modified residuei816PhosphoserineCombined sources1
Modified residuei818PhosphoserineCombined sources1
Modified residuei819PhosphothreonineCombined sources1
Modified residuei822PhosphoserineCombined sources1
Modified residuei832PhosphoserineCombined sources1
Modified residuei834PhosphothreonineCombined sources1
Modified residuei836PhosphoserineCombined sources1
Modified residuei838PhosphoserineCombined sources1
Modified residuei843PhosphoserineCombined sources1
Modified residuei913PhosphothreonineCombined sources1
Modified residuei915PhosphoserineCombined sources1
Modified residuei943PhosphoserineBy similarity1

Post-translational modificationi

Citrullinated by PADI4.1 Publication

Keywords - PTMi

Acetylation, Citrullination, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ52KI8.
PaxDbiQ52KI8.
PeptideAtlasiQ52KI8.
PRIDEiQ52KI8.

PTM databases

iPTMnetiQ52KI8.
PhosphoSitePlusiQ52KI8.

Expressioni

Gene expression databases

BgeeiENSMUSG00000028809.
CleanExiMM_SRRM1.

Interactioni

Subunit structurei

Identified in the spliceosome C complex. Found in a pre-mRNA splicing complex with SFRS4, SFRS5, SNRP70, SNRPA1, SRRM1 and SRRM2. Found in a pre-mRNA exonic splicing enhancer (ESE) complex with SNRP70, SNRPA1, SRRM1 and TRA2B/SFRS10. Found in a mRNA splicing-dependent exon junction complex (EJC) with DEK, PRPF8, NCBP1, RBM8A, RNPS1, SRRM1 and ALYREF/THOC4. Interacts with BAT1, CPSF1, RBM8A, RNPS1, and ALYREF/THOC4. Seems to be a compound of RNA export complexes that are released from speckles in a ATP-dependent manner (By similarity).By similarity

Protein-protein interaction databases

BioGridi206179. 2 interactors.
IntActiQ52KI8. 2 interactors.
MINTiMINT-1867213.
STRINGi10090.ENSMUSP00000125003.

Structurei

3D structure databases

ProteinModelPortaliQ52KI8.
SMRiQ52KI8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini27 – 126PWIPROSITE-ProRule annotationAdd BLAST100

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 156Necessary for mRNA 3'-end cleavage and cytoplasmic accumulationBy similarityAdd BLAST156
Regioni1 – 151Necessary for DNA and RNA-bindingBy similarityAdd BLAST151
Regioni298 – 707Necessary for speckles and matrix localizationBy similarityAdd BLAST410

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi163 – 767Arg-richAdd BLAST605
Compositional biasi276 – 500Ser-richAdd BLAST225
Compositional biasi309 – 415Pro-richAdd BLAST107
Compositional biasi562 – 839Pro-richAdd BLAST278
Compositional biasi850 – 876Lys-richAdd BLAST27

Sequence similaritiesi

Belongs to the splicing factor SR family.Curated
Contains 1 PWI domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2146. Eukaryota.
ENOG4111IMU. LUCA.
HOGENOMiHOG000168326.
HOVERGENiHBG054044.
InParanoidiQ52KI8.
KOiK13171.

Family and domain databases

Gene3Di1.20.1390.10. 1 hit.
InterProiIPR002483. PWI_dom.
[Graphical view]
PfamiPF01480. PWI. 1 hit.
[Graphical view]
SMARTiSM00311. PWI. 1 hit.
[Graphical view]
SUPFAMiSSF101233. SSF101233. 1 hit.
PROSITEiPS51025. PWI. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q52KI8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDAGFFRGTS AEQDNRFSNK QKKLLKQLKF AECLEKKVDM SKVNLEVIKP
60 70 80 90 100
WITKRVTEIL GFEDDVVIEF IFNQLEVKNP DSKMMQINLT GFLNGKNARE
110 120 130 140 150
FMGELWPLLL SAQENIAGIP SAFLELKKEE IKQRQIEQEK LASLKKQDED
160 170 180 190 200
KDKRDKEEKE SSREKRERSR SPRRRKSRSP SPRRRSSPVR RERKRSHSRS
210 220 230 240 250
PRHRTKSRSP SPAPEKKEKS PELPEPSVRM KDSSVQEATS TSDILKAPKP
260 270 280 290 300
EPVPEPKEPS PEKNSKKEKE KTRPRSRSRS KSRSRTRSRS PSHTRPRRRH
310 320 330 340 350
RSRSRSYSPR RRPSPRRRPS PRRRTPPRRM PPPPRHRRSR SPGRRRRRSS
360 370 380 390 400
ASLSGSSSSS SSSRSRSPPK KPPKRTSSPP RKTRRLSPSA SPPRRRHRPS
410 420 430 440 450
SPATPPPKTR HSPTPQQSNR TRKSRVSVSP GRTSGKVTKH KGTEKRESPS
460 470 480 490 500
PAPKPRKVEL SESEEDKGSK MAAADSVQQR RQYRRQNQQS SSDSGSSSTS
510 520 530 540 550
EDERPKRSHV KNGEVGRRRR HSPSRSASPS PRKRQKETSP RMQMGKRWQS
560 570 580 590 600
PVTKSSRRRR SPSPPPARRR RSPSPAPPPP PPPPPPRRRR SPTPPPRRRT
610 620 630 640 650
PSPPPRRRSP SPRRYSPPIQ RRYSPSPPPK RRTASPPPPP KRRASPSPPP
660 670 680 690 700
KRRVSHSPPP KQRSPTVTKR RSPSLSSKHR KGSSPGRSTR EARSPQPNKR
710 720 730 740 750
HSPSPRPRAP QTSSPPPVRR GASASPQGRQ SPSPSTRPIR RVSRTPEPKK
760 770 780 790 800
IKKTAMATQR NIRRVSKSPK ADSLSRAASP SPQSVRRVSS SRSVSGSPEP
810 820 830 840 850
AAKKPPAPPS PVQSQSPSTN WSPAVPAKKA KSPTPSLSPA RNSDQEGGGK
860 870 880 890 900
KKKKKKDKKH KKDKKHKKHK KHKKEKAVTI ATPATAAPAA VSAATTTSAQ
910 920 930 940
EEPAAAPEPR KETESEAEDD NLDDLERHLR EKALRSMRKA QVSPQS
Length:946
Mass (Da):106,862
Last modified:September 21, 2011 - v2
Checksum:i41F77542412A9536
GO
Isoform 2 (identifier: Q52KI8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     733-755: Missing.
     911-946: KETESEAEDDNLDDLERHLREKALRSMRKAQVSPQS → EVFTPPLPAV

Show »
Length:897
Mass (Da):101,103
Checksum:iC648F17FBD19FED1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti187S → Y in BAB25575 (PubMed:16141072).Curated1
Sequence conflicti521H → L in AAC17422 (Ref. 1) Curated1
Sequence conflicti754 – 761TAMATQRN → AASPSTRP in AAH94322 (PubMed:15489334).Curated8
Sequence conflicti767 – 776KSPKADSLSR → RTPEPKKIKK in AAH94322 (PubMed:15489334).Curated10
Sequence conflicti851K → R in AAC17422 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016524733 – 755Missing in isoform 2. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_016525911 – 946KETES…VSPQS → EVFTPPLPAV in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF062655 mRNA. Translation: AAC17422.1.
AL627078 Genomic DNA. No translation available.
AL627185 Genomic DNA. No translation available.
BC094322 mRNA. Translation: AAH94322.1.
AK008284 mRNA. Translation: BAB25575.1.
RefSeqiNP_058079.2. NM_016799.3.
UniGeneiMm.1963.

Genome annotation databases

GeneIDi51796.
KEGGimmu:51796.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF062655 mRNA. Translation: AAC17422.1.
AL627078 Genomic DNA. No translation available.
AL627185 Genomic DNA. No translation available.
BC094322 mRNA. Translation: AAH94322.1.
AK008284 mRNA. Translation: BAB25575.1.
RefSeqiNP_058079.2. NM_016799.3.
UniGeneiMm.1963.

3D structure databases

ProteinModelPortaliQ52KI8.
SMRiQ52KI8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi206179. 2 interactors.
IntActiQ52KI8. 2 interactors.
MINTiMINT-1867213.
STRINGi10090.ENSMUSP00000125003.

PTM databases

iPTMnetiQ52KI8.
PhosphoSitePlusiQ52KI8.

Proteomic databases

EPDiQ52KI8.
PaxDbiQ52KI8.
PeptideAtlasiQ52KI8.
PRIDEiQ52KI8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi51796.
KEGGimmu:51796.

Organism-specific databases

CTDi10250.
MGIiMGI:1858303. Srrm1.

Phylogenomic databases

eggNOGiKOG2146. Eukaryota.
ENOG4111IMU. LUCA.
HOGENOMiHOG000168326.
HOVERGENiHBG054044.
InParanoidiQ52KI8.
KOiK13171.

Miscellaneous databases

ChiTaRSiSrrm1. mouse.
PROiQ52KI8.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000028809.
CleanExiMM_SRRM1.

Family and domain databases

Gene3Di1.20.1390.10. 1 hit.
InterProiIPR002483. PWI_dom.
[Graphical view]
PfamiPF01480. PWI. 1 hit.
[Graphical view]
SMARTiSM00311. PWI. 1 hit.
[Graphical view]
SUPFAMiSSF101233. SSF101233. 1 hit.
PROSITEiPS51025. PWI. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSRRM1_MOUSE
AccessioniPrimary (citable) accession number: Q52KI8
Secondary accession number(s): E9QNW8, O70495, Q9CVG5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: September 21, 2011
Last modified: November 2, 2016
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.