Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q505H4

- VWC2L_MOUSE

UniProt

Q505H4 - VWC2L_MOUSE

Protein

von Willebrand factor C domain-containing protein 2-like

Gene

Vwc2l

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 63 (01 Oct 2014)
      Sequence version 1 (07 Jun 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in neurogenesis. May promote matrix mineralization (PubMed:22209847), but has been shown to weakly, but significantly inhibit BMP2 and BMP6 activity in a preosteoblastic cell line (PubMed:19852960).2 Publications

    GO - Biological processi

    1. negative regulation of BMP signaling pathway Source: MGI
    2. positive regulation of neuron differentiation Source: MGI

    Keywords - Molecular functioni

    Developmental protein

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    von Willebrand factor C domain-containing protein 2-like
    Alternative name(s):
    Brorin-like
    Gene namesi
    Name:Vwc2l
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 1

    Organism-specific databases

    MGIiMGI:2444069. Vwc2l.

    Subcellular locationi

    GO - Cellular componenti

    1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: MGI
    2. cell junction Source: UniProtKB-KW
    3. extracellular space Source: MGI
    4. synapse Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Secreted, Synapse

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2121Sequence AnalysisAdd
    BLAST
    Chaini22 – 222201von Willebrand factor C domain-containing protein 2-likePRO_0000348062Add
    BLAST

    Proteomic databases

    PRIDEiQ505H4.

    Expressioni

    Tissue specificityi

    Predominantly expressed in the brain (at protein level). Also detected in bones, including femur and calvaria, heart, lung and kidney. Isoform 5 is predominant in lung and heart, compared to isoforms 1 and 3. Isoform 4 is expressed in femur and calvaria at higher levels than isoforms 1 and 5. Isoforms 1 and 4 are expressed at higher levels than isoform 5 in kidney and brain.3 Publications

    Developmental stagei

    From 12.5 dpc to 18.5 dpc, expressed in the developing neural tissues, including several discrete regions in the forebrain, midbrain and hindbrain, as well as in the spinal cord. May be up-regulated in the course of preosteblast differentiation and matrix mineralization.2 Publications

    Gene expression databases

    BgeeiQ505H4.
    GenevestigatoriQ505H4.

    Interactioni

    Subunit structurei

    Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including VWC2L. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing.1 Publication

    Structurei

    3D structure databases

    ProteinModelPortaliQ505H4.
    SMRiQ505H4. Positions 50-217.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini51 – 11060VWFC 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini114 – 17259VWFC 2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 2 VWFC domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal

    Phylogenomic databases

    eggNOGiNOG83498.
    GeneTreeiENSGT00720000108792.
    HOGENOMiHOG000036086.
    HOVERGENiHBG068398.
    InParanoidiQ505H4.
    OMAiCLRRECL.
    OrthoDBiEOG73Z2TT.
    PhylomeDBiQ505H4.
    TreeFamiTF329913.

    Family and domain databases

    InterProiIPR001007. VWF_C.
    [Graphical view]
    SMARTiSM00214. VWC. 1 hit.
    [Graphical view]
    PROSITEiPS01208. VWFC_1. 1 hit.
    PS50184. VWFC_2. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q505H4-1) [UniParc]FASTAAdd to Basket

    Also known as: F12-a, Vwc2l-1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MALHIHEACI LLLVIPGLVT SAAISHEDYP ADEGDQASSN DNLIFDDYRG    50
    KGCVDDSGFV YKLGERFFPG HSNCPCVCAL DGPVCDQPEC PKIHPKCTKV 100
    EHNGCCPECK EVKNFCEYHG KNYKILEEFK PSPCEWCRCE PSNEVHCVVA 150
    DCAVPECVNP IYEPEQCCPV CKNGPNCFAG TTIIPAGIEV KVDDCNICHC 200
    HNGDWWKPAQ CSKRECQGKQ TV 222
    Length:222
    Mass (Da):24,528
    Last modified:June 7, 2005 - v1
    Checksum:i6F40D6393609DD54
    GO
    Isoform 2 (identifier: Q505H4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         34-80: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:175
    Mass (Da):19,427
    Checksum:iDE22500668F0C26E
    GO
    Isoform 3 (identifier: Q505H4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-35: MALHIHEACILLLVIPGLVTSAAISHEDYPADEGD → MKLAYFYWSSLDWSPLLPSVTKTILLMKVS
         131-131: P → V
         132-222: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:126
    Mass (Da):14,326
    Checksum:i16518F47088559E1
    GO
    Isoform 4 (identifier: Q505H4-4) [UniParc]FASTAAdd to Basket

    Also known as: F12-b, Vwc2l-2

    The sequence of this isoform differs from the canonical sequence as follows:
         131-139: PSPCEWCRC → VQTALQELQ
         140-222: Missing.

    Show »
    Length:139
    Mass (Da):15,434
    Checksum:i8EF0B1AEB63C5F88
    GO
    Isoform 5 (identifier: Q505H4-5) [UniParc]FASTAAdd to Basket

    Also known as: F12-c, Vwc2l-3

    The sequence of this isoform differs from the canonical sequence as follows:
         34-80: Missing.
         131-139: PSPCEWCRC → VQTALQELQ
         140-222: Missing.

    Show »
    Length:92
    Mass (Da):10,333
    Checksum:i953141F8EA178A48
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3535MALHI…ADEGD → MKLAYFYWSSLDWSPLLPSV TKTILLMKVS in isoform 3. 1 PublicationVSP_035090Add
    BLAST
    Alternative sequencei34 – 8047Missing in isoform 2 and isoform 5. 2 PublicationsVSP_035091Add
    BLAST
    Alternative sequencei131 – 1399PSPCEWCRC → VQTALQELQ in isoform 4 and isoform 5. 1 PublicationVSP_044591
    Alternative sequencei131 – 1311P → V in isoform 3. 1 PublicationVSP_035092
    Alternative sequencei132 – 22291Missing in isoform 3. 1 PublicationVSP_035093Add
    BLAST
    Alternative sequencei140 – 22283Missing in isoform 4 and isoform 5. 1 PublicationVSP_044592Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB374230 mRNA. Translation: BAH04175.1.
    EF552208 mRNA. Translation: ABU41138.1.
    EF552209 mRNA. Translation: ABU41139.1.
    EF552210 mRNA. Translation: ABU41140.1.
    AK080585 mRNA. Translation: BAC37948.1.
    AK083856 mRNA. Translation: BAC39040.1.
    AC129933 Genomic DNA. No translation available.
    AC130481 Genomic DNA. No translation available.
    BC094541 mRNA. Translation: AAH94541.1.
    CCDSiCCDS15028.1. [Q505H4-1]
    RefSeqiNP_796138.2. NM_177164.3. [Q505H4-1]
    XP_006496126.1. XM_006496063.1. [Q505H4-1]
    XP_006496128.1. XM_006496065.1. [Q505H4-4]
    UniGeneiMm.360649.

    Genome annotation databases

    EnsembliENSMUST00000053922; ENSMUSP00000058142; ENSMUSG00000045648. [Q505H4-1]
    ENSMUST00000161937; ENSMUSP00000125014; ENSMUSG00000045648. [Q505H4-4]
    ENSMUST00000162182; ENSMUSP00000123819; ENSMUSG00000045648. [Q505H4-2]
    GeneIDi320460.
    KEGGimmu:320460.
    UCSCiuc007bjj.1. mouse.
    uc007bjk.1. mouse. [Q505H4-1]
    uc011wmo.1. mouse. [Q505H4-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB374230 mRNA. Translation: BAH04175.1 .
    EF552208 mRNA. Translation: ABU41138.1 .
    EF552209 mRNA. Translation: ABU41139.1 .
    EF552210 mRNA. Translation: ABU41140.1 .
    AK080585 mRNA. Translation: BAC37948.1 .
    AK083856 mRNA. Translation: BAC39040.1 .
    AC129933 Genomic DNA. No translation available.
    AC130481 Genomic DNA. No translation available.
    BC094541 mRNA. Translation: AAH94541.1 .
    CCDSi CCDS15028.1. [Q505H4-1 ]
    RefSeqi NP_796138.2. NM_177164.3. [Q505H4-1 ]
    XP_006496126.1. XM_006496063.1. [Q505H4-1 ]
    XP_006496128.1. XM_006496065.1. [Q505H4-4 ]
    UniGenei Mm.360649.

    3D structure databases

    ProteinModelPortali Q505H4.
    SMRi Q505H4. Positions 50-217.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PRIDEi Q505H4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000053922 ; ENSMUSP00000058142 ; ENSMUSG00000045648 . [Q505H4-1 ]
    ENSMUST00000161937 ; ENSMUSP00000125014 ; ENSMUSG00000045648 . [Q505H4-4 ]
    ENSMUST00000162182 ; ENSMUSP00000123819 ; ENSMUSG00000045648 . [Q505H4-2 ]
    GeneIDi 320460.
    KEGGi mmu:320460.
    UCSCi uc007bjj.1. mouse.
    uc007bjk.1. mouse. [Q505H4-1 ]
    uc011wmo.1. mouse. [Q505H4-2 ]

    Organism-specific databases

    CTDi 402117.
    MGIi MGI:2444069. Vwc2l.

    Phylogenomic databases

    eggNOGi NOG83498.
    GeneTreei ENSGT00720000108792.
    HOGENOMi HOG000036086.
    HOVERGENi HBG068398.
    InParanoidi Q505H4.
    OMAi CLRRECL.
    OrthoDBi EOG73Z2TT.
    PhylomeDBi Q505H4.
    TreeFami TF329913.

    Miscellaneous databases

    NextBioi 35553090.
    PROi Q505H4.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q505H4.
    Genevestigatori Q505H4.

    Family and domain databases

    InterProi IPR001007. VWF_C.
    [Graphical view ]
    SMARTi SM00214. VWC. 1 hit.
    [Graphical view ]
    PROSITEi PS01208. VWFC_1. 1 hit.
    PS50184. VWFC_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A novel neural-specific BMP antagonist, Brorin-like, of the Chordin family."
      Miwa H., Miyake A., Kouta Y., Shimada A., Yamashita Y., Nakayama Y., Yamauchi H., Konishi M., Itoh N.
      FEBS Lett. 583:3643-3648(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    2. "Modulation of matrix mineralization by Vwc2-like protein and its novel splicing isoforms."
      Ohyama Y., Katafuchi M., Almehmadi A., Venkitapathi S., Jaha H., Ehrenman J., Morcos J., Aljamaan R., Mochida Y.
      Biochem. Biophys. Res. Commun. 418:12-16(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 4 AND 5), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Strain: BALB/c.
      Tissue: Brain.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Strain: C57BL/6J.
      Tissue: Brain cortex and Spinal ganglion.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6.
      Tissue: Brain.
    6. "High-resolution proteomics unravel architecture and molecular diversity of native AMPA receptor complexes."
      Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H., Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N., Schulte U., Fakler B.
      Neuron 74:621-633(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN AMPAR COMPLEX, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiVWC2L_MOUSE
    AccessioniPrimary (citable) accession number: Q505H4
    Secondary accession number(s): B7X8X0
    , E0CXU0, E6Y2G9, Q8BNE9, Q8BNU5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 2, 2008
    Last sequence update: June 7, 2005
    Last modified: October 1, 2014
    This is version 63 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3