Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q505H4 (VWC2L_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 62. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
von Willebrand factor C domain-containing protein 2-like
Alternative name(s):
Brorin-like
Gene names
Name:Vwc2l
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length222 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role in neurogenesis. May promote matrix mineralization (Ref.2), but has been shown to weakly, but significantly inhibit BMP2 and BMP6 activity in a preosteoblastic cell line (Ref.1). Ref.1 Ref.2

Subunit structure

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including VWC2L. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing. Ref.6

Subcellular location

Secreted. Cell junctionsynapse Probable Ref.1 Ref.2 Ref.6.

Tissue specificity

Predominantly expressed in the brain (at protein level). Also detected in bones, including femur and calvaria, heart, lung and kidney. Isoform 5 is predominant in lung and heart, compared to isoforms 1 and 3. Isoform 4 is expressed in femur and calvaria at higher levels than isoforms 1 and 5. Isoforms 1 and 4 are expressed at higher levels than isoform 5 in kidney and brain. Ref.1 Ref.2 Ref.6

Developmental stage

From 12.5 dpc to 18.5 dpc, expressed in the developing neural tissues, including several discrete regions in the forebrain, midbrain and hindbrain, as well as in the spinal cord. May be up-regulated in the course of preosteblast differentiation and matrix mineralization. Ref.1 Ref.2

Sequence similarities

Contains 2 VWFC domains.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q505H4-1)

Also known as: F12-a; Vwc2l-1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q505H4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     34-80: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q505H4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MALHIHEACILLLVIPGLVTSAAISHEDYPADEGD → MKLAYFYWSSLDWSPLLPSVTKTILLMKVS
     131-131: P → V
     132-222: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q505H4-4)

Also known as: F12-b; Vwc2l-2;

The sequence of this isoform differs from the canonical sequence as follows:
     131-139: PSPCEWCRC → VQTALQELQ
     140-222: Missing.
Isoform 5 (identifier: Q505H4-5)

Also known as: F12-c; Vwc2l-3;

The sequence of this isoform differs from the canonical sequence as follows:
     34-80: Missing.
     131-139: PSPCEWCRC → VQTALQELQ
     140-222: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2121 Potential
Chain22 – 222201von Willebrand factor C domain-containing protein 2-like
PRO_0000348062

Regions

Domain51 – 11060VWFC 1
Domain114 – 17259VWFC 2

Natural variations

Alternative sequence1 – 3535MALHI…ADEGD → MKLAYFYWSSLDWSPLLPSV TKTILLMKVS in isoform 3.
VSP_035090
Alternative sequence34 – 8047Missing in isoform 2 and isoform 5.
VSP_035091
Alternative sequence131 – 1399PSPCEWCRC → VQTALQELQ in isoform 4 and isoform 5.
VSP_044591
Alternative sequence1311P → V in isoform 3.
VSP_035092
Alternative sequence132 – 22291Missing in isoform 3.
VSP_035093
Alternative sequence140 – 22283Missing in isoform 4 and isoform 5.
VSP_044592

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (F12-a) (Vwc2l-1) [UniParc].

Last modified June 7, 2005. Version 1.
Checksum: 6F40D6393609DD54

FASTA22224,528
        10         20         30         40         50         60 
MALHIHEACI LLLVIPGLVT SAAISHEDYP ADEGDQASSN DNLIFDDYRG KGCVDDSGFV 

        70         80         90        100        110        120 
YKLGERFFPG HSNCPCVCAL DGPVCDQPEC PKIHPKCTKV EHNGCCPECK EVKNFCEYHG 

       130        140        150        160        170        180 
KNYKILEEFK PSPCEWCRCE PSNEVHCVVA DCAVPECVNP IYEPEQCCPV CKNGPNCFAG 

       190        200        210        220 
TTIIPAGIEV KVDDCNICHC HNGDWWKPAQ CSKRECQGKQ TV 

« Hide

Isoform 2 [UniParc].

Checksum: DE22500668F0C26E
Show »

FASTA17519,427
Isoform 3 [UniParc].

Checksum: 16518F47088559E1
Show »

FASTA12614,326
Isoform 4 (F12-b) (Vwc2l-2) [UniParc].

Checksum: 8EF0B1AEB63C5F88
Show »

FASTA13915,434
Isoform 5 (F12-c) (Vwc2l-3) [UniParc].

Checksum: 953141F8EA178A48
Show »

FASTA9210,333

References

« Hide 'large scale' references
[1]"A novel neural-specific BMP antagonist, Brorin-like, of the Chordin family."
Miwa H., Miyake A., Kouta Y., Shimada A., Yamashita Y., Nakayama Y., Yamauchi H., Konishi M., Itoh N.
FEBS Lett. 583:3643-3648(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
[2]"Modulation of matrix mineralization by Vwc2-like protein and its novel splicing isoforms."
Ohyama Y., Katafuchi M., Almehmadi A., Venkitapathi S., Jaha H., Ehrenman J., Morcos J., Aljamaan R., Mochida Y.
Biochem. Biophys. Res. Commun. 418:12-16(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 4 AND 5), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Strain: BALB/c.
Tissue: Brain.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Strain: C57BL/6J.
Tissue: Brain cortex and Spinal ganglion.
[4]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6.
Tissue: Brain.
[6]"High-resolution proteomics unravel architecture and molecular diversity of native AMPA receptor complexes."
Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H., Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N., Schulte U., Fakler B.
Neuron 74:621-633(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION IN AMPAR COMPLEX, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB374230 mRNA. Translation: BAH04175.1.
EF552208 mRNA. Translation: ABU41138.1.
EF552209 mRNA. Translation: ABU41139.1.
EF552210 mRNA. Translation: ABU41140.1.
AK080585 mRNA. Translation: BAC37948.1.
AK083856 mRNA. Translation: BAC39040.1.
AC129933 Genomic DNA. No translation available.
AC130481 Genomic DNA. No translation available.
BC094541 mRNA. Translation: AAH94541.1.
CCDSCCDS15028.1. [Q505H4-1]
RefSeqNP_796138.2. NM_177164.3. [Q505H4-1]
XP_006496126.1. XM_006496063.1. [Q505H4-1]
XP_006496128.1. XM_006496065.1. [Q505H4-4]
UniGeneMm.360649.

3D structure databases

ProteinModelPortalQ505H4.
SMRQ505H4. Positions 50-217.
ModBaseSearch...
MobiDBSearch...

Proteomic databases

PRIDEQ505H4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000053922; ENSMUSP00000058142; ENSMUSG00000045648. [Q505H4-1]
ENSMUST00000161937; ENSMUSP00000125014; ENSMUSG00000045648. [Q505H4-4]
ENSMUST00000162182; ENSMUSP00000123819; ENSMUSG00000045648. [Q505H4-2]
GeneID320460.
KEGGmmu:320460.
UCSCuc007bjj.1. mouse.
uc007bjk.1. mouse. [Q505H4-1]
uc011wmo.1. mouse. [Q505H4-2]

Organism-specific databases

CTD402117.
MGIMGI:2444069. Vwc2l.

Phylogenomic databases

eggNOGNOG83498.
GeneTreeENSGT00720000108792.
HOGENOMHOG000036086.
HOVERGENHBG068398.
InParanoidQ505H4.
OMACLRRECL.
OrthoDBEOG73Z2TT.
PhylomeDBQ505H4.
TreeFamTF329913.

Gene expression databases

BgeeQ505H4.
GenevestigatorQ505H4.

Family and domain databases

InterProIPR001007. VWF_C.
[Graphical view]
SMARTSM00214. VWC. 1 hit.
[Graphical view]
PROSITEPS01208. VWFC_1. 1 hit.
PS50184. VWFC_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio35553090.
PROQ505H4.
SOURCESearch...

Entry information

Entry nameVWC2L_MOUSE
AccessionPrimary (citable) accession number: Q505H4
Secondary accession number(s): B7X8X0 expand/collapse secondary AC list , E0CXU0, E6Y2G9, Q8BNE9, Q8BNU5
Entry history
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: June 7, 2005
Last modified: July 9, 2014
This is version 62 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot