Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q505H4

- VWC2L_MOUSE

UniProt

Q505H4 - VWC2L_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

von Willebrand factor C domain-containing protein 2-like

Gene

Vwc2l

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May play a role in neurogenesis. May promote matrix mineralization (PubMed:22209847), but has been shown to weakly, but significantly inhibit BMP2 and BMP6 activity in a preosteoblastic cell line (PubMed:19852960).2 Publications

GO - Biological processi

  1. negative regulation of BMP signaling pathway Source: MGI
  2. positive regulation of neuron differentiation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
von Willebrand factor C domain-containing protein 2-like
Alternative name(s):
Brorin-like
Gene namesi
Name:Vwc2l
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 1

Organism-specific databases

MGIiMGI:2444069. Vwc2l.

Subcellular locationi

GO - Cellular componenti

  1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: MGI
  2. cell junction Source: UniProtKB-KW
  3. extracellular space Source: MGI
  4. synapse Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Secreted, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2121Sequence AnalysisAdd
BLAST
Chaini22 – 222201von Willebrand factor C domain-containing protein 2-likePRO_0000348062Add
BLAST

Proteomic databases

PRIDEiQ505H4.

Expressioni

Tissue specificityi

Predominantly expressed in the brain (at protein level). Also detected in bones, including femur and calvaria, heart, lung and kidney. Isoform 5 is predominant in lung and heart, compared to isoforms 1 and 3. Isoform 4 is expressed in femur and calvaria at higher levels than isoforms 1 and 5. Isoforms 1 and 4 are expressed at higher levels than isoform 5 in kidney and brain.3 Publications

Developmental stagei

From 12.5 dpc to 18.5 dpc, expressed in the developing neural tissues, including several discrete regions in the forebrain, midbrain and hindbrain, as well as in the spinal cord. May be up-regulated in the course of preosteblast differentiation and matrix mineralization.2 Publications

Gene expression databases

BgeeiQ505H4.
GenevestigatoriQ505H4.

Interactioni

Subunit structurei

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including VWC2L. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing.1 Publication

Structurei

3D structure databases

ProteinModelPortaliQ505H4.
SMRiQ505H4. Positions 52-90, 97-152, 163-216.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini51 – 11060VWFC 1PROSITE-ProRule annotationAdd
BLAST
Domaini114 – 17259VWFC 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 VWFC domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiNOG83498.
GeneTreeiENSGT00720000108792.
HOGENOMiHOG000036086.
HOVERGENiHBG068398.
InParanoidiQ505H4.
OMAiCLRRECL.
OrthoDBiEOG73Z2TT.
PhylomeDBiQ505H4.
TreeFamiTF329913.

Family and domain databases

InterProiIPR001007. VWF_C.
[Graphical view]
SMARTiSM00214. VWC. 1 hit.
[Graphical view]
PROSITEiPS01208. VWFC_1. 1 hit.
PS50184. VWFC_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q505H4-1) [UniParc]FASTAAdd to Basket

Also known as: F12-a, Vwc2l-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALHIHEACI LLLVIPGLVT SAAISHEDYP ADEGDQASSN DNLIFDDYRG
60 70 80 90 100
KGCVDDSGFV YKLGERFFPG HSNCPCVCAL DGPVCDQPEC PKIHPKCTKV
110 120 130 140 150
EHNGCCPECK EVKNFCEYHG KNYKILEEFK PSPCEWCRCE PSNEVHCVVA
160 170 180 190 200
DCAVPECVNP IYEPEQCCPV CKNGPNCFAG TTIIPAGIEV KVDDCNICHC
210 220
HNGDWWKPAQ CSKRECQGKQ TV
Length:222
Mass (Da):24,528
Last modified:June 7, 2005 - v1
Checksum:i6F40D6393609DD54
GO
Isoform 2 (identifier: Q505H4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     34-80: Missing.

Note: No experimental confirmation available.

Show »
Length:175
Mass (Da):19,427
Checksum:iDE22500668F0C26E
GO
Isoform 3 (identifier: Q505H4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MALHIHEACILLLVIPGLVTSAAISHEDYPADEGD → MKLAYFYWSSLDWSPLLPSVTKTILLMKVS
     131-131: P → V
     132-222: Missing.

Note: No experimental confirmation available.

Show »
Length:126
Mass (Da):14,326
Checksum:i16518F47088559E1
GO
Isoform 4 (identifier: Q505H4-4) [UniParc]FASTAAdd to Basket

Also known as: F12-b, Vwc2l-2

The sequence of this isoform differs from the canonical sequence as follows:
     131-139: PSPCEWCRC → VQTALQELQ
     140-222: Missing.

Show »
Length:139
Mass (Da):15,434
Checksum:i8EF0B1AEB63C5F88
GO
Isoform 5 (identifier: Q505H4-5) [UniParc]FASTAAdd to Basket

Also known as: F12-c, Vwc2l-3

The sequence of this isoform differs from the canonical sequence as follows:
     34-80: Missing.
     131-139: PSPCEWCRC → VQTALQELQ
     140-222: Missing.

Show »
Length:92
Mass (Da):10,333
Checksum:i953141F8EA178A48
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3535MALHI…ADEGD → MKLAYFYWSSLDWSPLLPSV TKTILLMKVS in isoform 3. 1 PublicationVSP_035090Add
BLAST
Alternative sequencei34 – 8047Missing in isoform 2 and isoform 5. 2 PublicationsVSP_035091Add
BLAST
Alternative sequencei131 – 1399PSPCEWCRC → VQTALQELQ in isoform 4 and isoform 5. 1 PublicationVSP_044591
Alternative sequencei131 – 1311P → V in isoform 3. 1 PublicationVSP_035092
Alternative sequencei132 – 22291Missing in isoform 3. 1 PublicationVSP_035093Add
BLAST
Alternative sequencei140 – 22283Missing in isoform 4 and isoform 5. 1 PublicationVSP_044592Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB374230 mRNA. Translation: BAH04175.1.
EF552208 mRNA. Translation: ABU41138.1.
EF552209 mRNA. Translation: ABU41139.1.
EF552210 mRNA. Translation: ABU41140.1.
AK080585 mRNA. Translation: BAC37948.1.
AK083856 mRNA. Translation: BAC39040.1.
AC129933 Genomic DNA. No translation available.
AC130481 Genomic DNA. No translation available.
BC094541 mRNA. Translation: AAH94541.1.
CCDSiCCDS15028.1. [Q505H4-1]
RefSeqiNP_796138.2. NM_177164.3. [Q505H4-1]
XP_006496126.1. XM_006496063.1. [Q505H4-1]
XP_006496128.1. XM_006496065.1. [Q505H4-4]
UniGeneiMm.360649.

Genome annotation databases

EnsembliENSMUST00000053922; ENSMUSP00000058142; ENSMUSG00000045648. [Q505H4-1]
ENSMUST00000161937; ENSMUSP00000125014; ENSMUSG00000045648. [Q505H4-4]
ENSMUST00000162182; ENSMUSP00000123819; ENSMUSG00000045648. [Q505H4-2]
GeneIDi320460.
KEGGimmu:320460.
UCSCiuc007bjj.1. mouse.
uc007bjk.1. mouse. [Q505H4-1]
uc011wmo.1. mouse. [Q505H4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB374230 mRNA. Translation: BAH04175.1 .
EF552208 mRNA. Translation: ABU41138.1 .
EF552209 mRNA. Translation: ABU41139.1 .
EF552210 mRNA. Translation: ABU41140.1 .
AK080585 mRNA. Translation: BAC37948.1 .
AK083856 mRNA. Translation: BAC39040.1 .
AC129933 Genomic DNA. No translation available.
AC130481 Genomic DNA. No translation available.
BC094541 mRNA. Translation: AAH94541.1 .
CCDSi CCDS15028.1. [Q505H4-1 ]
RefSeqi NP_796138.2. NM_177164.3. [Q505H4-1 ]
XP_006496126.1. XM_006496063.1. [Q505H4-1 ]
XP_006496128.1. XM_006496065.1. [Q505H4-4 ]
UniGenei Mm.360649.

3D structure databases

ProteinModelPortali Q505H4.
SMRi Q505H4. Positions 52-90, 97-152, 163-216.
ModBasei Search...
MobiDBi Search...

Proteomic databases

PRIDEi Q505H4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000053922 ; ENSMUSP00000058142 ; ENSMUSG00000045648 . [Q505H4-1 ]
ENSMUST00000161937 ; ENSMUSP00000125014 ; ENSMUSG00000045648 . [Q505H4-4 ]
ENSMUST00000162182 ; ENSMUSP00000123819 ; ENSMUSG00000045648 . [Q505H4-2 ]
GeneIDi 320460.
KEGGi mmu:320460.
UCSCi uc007bjj.1. mouse.
uc007bjk.1. mouse. [Q505H4-1 ]
uc011wmo.1. mouse. [Q505H4-2 ]

Organism-specific databases

CTDi 402117.
MGIi MGI:2444069. Vwc2l.

Phylogenomic databases

eggNOGi NOG83498.
GeneTreei ENSGT00720000108792.
HOGENOMi HOG000036086.
HOVERGENi HBG068398.
InParanoidi Q505H4.
OMAi CLRRECL.
OrthoDBi EOG73Z2TT.
PhylomeDBi Q505H4.
TreeFami TF329913.

Miscellaneous databases

NextBioi 35553090.
PROi Q505H4.
SOURCEi Search...

Gene expression databases

Bgeei Q505H4.
Genevestigatori Q505H4.

Family and domain databases

InterProi IPR001007. VWF_C.
[Graphical view ]
SMARTi SM00214. VWC. 1 hit.
[Graphical view ]
PROSITEi PS01208. VWFC_1. 1 hit.
PS50184. VWFC_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A novel neural-specific BMP antagonist, Brorin-like, of the Chordin family."
    Miwa H., Miyake A., Kouta Y., Shimada A., Yamashita Y., Nakayama Y., Yamauchi H., Konishi M., Itoh N.
    FEBS Lett. 583:3643-3648(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  2. "Modulation of matrix mineralization by Vwc2-like protein and its novel splicing isoforms."
    Ohyama Y., Katafuchi M., Almehmadi A., Venkitapathi S., Jaha H., Ehrenman J., Morcos J., Aljamaan R., Mochida Y.
    Biochem. Biophys. Res. Commun. 418:12-16(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 4 AND 5), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: BALB/c.
    Tissue: Brain.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: C57BL/6J.
    Tissue: Brain cortex and Spinal ganglion.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6.
    Tissue: Brain.
  6. "High-resolution proteomics unravel architecture and molecular diversity of native AMPA receptor complexes."
    Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H., Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N., Schulte U., Fakler B.
    Neuron 74:621-633(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN AMPAR COMPLEX, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiVWC2L_MOUSE
AccessioniPrimary (citable) accession number: Q505H4
Secondary accession number(s): B7X8X0
, E0CXU0, E6Y2G9, Q8BNE9, Q8BNU5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: June 7, 2005
Last modified: October 29, 2014
This is version 64 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3