Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/hydrogen exchanger 9B1

Gene

SLC9B1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Sperm-specific Na+/H+ exchanger involved in intracellular pH regulation of spermatozoa. Involved in sperm motility and fertility.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processAntiport, Fertilization, Ion transport, Sodium transport, Transport
LigandSodium

Enzyme and pathway databases

ReactomeiR-HSA-2672351 Stimuli-sensing channels

Protein family/group databases

TCDBi2.A.36.2.3 the monovalent cation:proton antiporter-1 (cpa1) family

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/hydrogen exchanger 9B1
Alternative name(s):
Na(+)/H(+) exchanger-like domain-containing protein 1
Short name:
NHE domain-containing protein 1
Sodium/hydrogen exchanger-like domain-containing protein 11 Publication
Solute carrier family 9, subfamily B member 1
Gene namesi
Name:SLC9B1Imported
Synonyms:NHA1Imported, NHEDC11 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000164037.16
HGNCiHGNC:24244 SLC9B1
MIMi611527 gene
neXtProtiNX_Q4ZJI4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei66 – 86HelicalSequence analysisAdd BLAST21
Transmembranei95 – 115HelicalSequence analysisAdd BLAST21
Transmembranei116 – 136HelicalSequence analysisAdd BLAST21
Transmembranei152 – 172HelicalSequence analysisAdd BLAST21
Transmembranei187 – 207HelicalSequence analysisAdd BLAST21
Transmembranei215 – 235HelicalSequence analysisAdd BLAST21
Transmembranei260 – 280HelicalSequence analysisAdd BLAST21
Transmembranei284 – 304HelicalSequence analysisAdd BLAST21
Transmembranei337 – 357HelicalSequence analysisAdd BLAST21
Transmembranei368 – 388HelicalSequence analysisAdd BLAST21
Transmembranei407 – 427HelicalSequence analysisAdd BLAST21
Transmembranei431 – 451HelicalSequence analysisAdd BLAST21
Transmembranei472 – 492HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Cell projection, Cilium, Flagellum, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi150159
OpenTargetsiENSG00000164037
PharmGKBiPA162397486

Polymorphism and mutation databases

BioMutaiSLC9B1
DMDMi296439240

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003140071 – 515Sodium/hydrogen exchanger 9B1Add BLAST515

Proteomic databases

PaxDbiQ4ZJI4
PeptideAtlasiQ4ZJI4
PRIDEiQ4ZJI4

PTM databases

iPTMnetiQ4ZJI4
PhosphoSitePlusiQ4ZJI4

Expressioni

Tissue specificityi

Expressed only in the testis.1 Publication

Gene expression databases

BgeeiENSG00000164037
CleanExiHS_NHEDC1
ExpressionAtlasiQ4ZJI4 baseline and differential
GenevisibleiQ4ZJI4 HS

Organism-specific databases

HPAiHPA035435
HPA058971
HPA065520

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000296422

Structurei

3D structure databases

ProteinModelPortaliQ4ZJI4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3826 Eukaryota
COG0025 LUCA
GeneTreeiENSGT00390000013285
HOVERGENiHBG108184
InParanoidiQ4ZJI4
OMAiPCLMEAC
OrthoDBiEOG091G06PH
PhylomeDBiQ4ZJI4
TreeFamiTF319087

Family and domain databases

InterProiView protein in InterPro
IPR006153 Cation/H_exchanger
IPR030187 SLC9B1
PANTHERiPTHR31102:SF5 PTHR31102:SF5, 1 hit
PfamiView protein in Pfam
PF00999 Na_H_Exchanger, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q4ZJI4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHTTESKNEH LEDENFQTST TPQSLIDPNN TAQEETKTVL SDTEEIKPQT
60 70 80 90 100
KKETYISCPL RGVLNVIITN GVILFVIWCM TWSILGSEAL PGGNLFGLFI
110 120 130 140 150
IFYSAIIGGK ILQLIRIPLV PPLPPLLGML LAGFTIRNVP FINEHVHVPN
160 170 180 190 200
TWSSILRSIA LTIILIRAGL GLDPQALRHL KVVCFRLAVG PCLMEASAAA
210 220 230 240 250
VFSHFIMKFP WQWAFLLGFV LGAVSPAVVV PYMMVLQENG YGVEEGIPTL
260 270 280 290 300
LMAASSMDDI LAITGFNTCL SIVFSSGGIL NNAIASIRNV CISLLAGIVL
310 320 330 340 350
GFFVRYFPSE DQKKLTLKRG FLVLTMCVSA VLGSQRIGLH GSGGLCTLVL
360 370 380 390 400
SFIAGTKWSQ EKMKVQKIIT TVWDIFQPLL FGLVGAEVSV SSLESNIVGI
410 420 430 440 450
SVATLSLALC VRILTTYLLM CFAGFSFKEK IFIALAWMPK ATVQAVLGPL
460 470 480 490 500
ALETARVSAP HLEPYAKDVM TVAFLAILIT APNGALLMGI LGPKMLTRHY
510
DPSKIKLQLS TLEHH
Length:515
Mass (Da):56,054
Last modified:May 18, 2010 - v2
Checksum:i37E89E22A8A910E5
GO
Isoform 2 (identifier: Q4ZJI4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: Missing.
     445-515: AVLGPLALET...KLQLSTLEHH → INQAILLLFLLREEWTNCKVAKKCEYTKERQ

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:243
Mass (Da):26,597
Checksum:i83F25B421DC4F400
GO
Isoform 3 (identifier: Q4ZJI4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     445-515: AVLGPLALET...KLQLSTLEHH → INQAILLLFLLREEWTNCKVAKKCEYTKERQ

Show »
Length:475
Mass (Da):52,180
Checksum:iD14FDA43C7F7CD44
GO
Isoform 4 (identifier: Q4ZJI4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-73: GVI → VLF
     74-515: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:73
Mass (Da):8,292
Checksum:i97A79AA3E2575845
GO

Sequence cautioni

The sequence AAM22868 differs from that shown. Reason: Frameshift at positions 219, 298 and 381.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti292I → T in AAS91021 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06137033Q → H5 PublicationsCorresponds to variant dbSNP:rs2715591Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0301751 – 232Missing in isoform 2. 1 PublicationAdd BLAST232
Alternative sequenceiVSP_03017671 – 73GVI → VLF in isoform 4. 1 Publication3
Alternative sequenceiVSP_03017774 – 515Missing in isoform 4. 1 PublicationAdd BLAST442
Alternative sequenceiVSP_030180445 – 515AVLGP…TLEHH → INQAILLLFLLREEWTNCKV AKKCEYTKERQ in isoform 2 and isoform 3. 2 PublicationsAdd BLAST71

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ003059 mRNA Translation: AAY21808.1
AF447585 mRNA Translation: AAM22868.1 Frameshift.
AY461581 mRNA Translation: AAS91021.1
AC018797 Genomic DNA No translation available.
AC083826 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06152.1
BC022079 mRNA No translation available.
BC046636 mRNA No translation available.
BC110794 mRNA Translation: AAI10795.1
BC132712 mRNA Translation: AAI32713.1
BC136966 mRNA Translation: AAI36967.1
CCDSiCCDS34041.1 [Q4ZJI4-1]
CCDS47119.1 [Q4ZJI4-3]
RefSeqiNP_001094344.1, NM_001100874.2
NP_631912.2, NM_139173.3
XP_006714156.1, XM_006714093.3 [Q4ZJI4-1]
XP_011529924.1, XM_011531622.1 [Q4ZJI4-1]
XP_011529925.1, XM_011531623.1 [Q4ZJI4-1]
UniGeneiHs.666728

Genome annotation databases

EnsembliENST00000296422; ENSP00000296422; ENSG00000164037 [Q4ZJI4-1]
ENST00000394789; ENSP00000378269; ENSG00000164037 [Q4ZJI4-3]
ENST00000503584; ENSP00000426926; ENSG00000164037 [Q4ZJI4-5]
ENST00000510243; ENSP00000425913; ENSG00000164037 [Q4ZJI4-5]
GeneIDi150159
KEGGihsa:150159
UCSCiuc003hwu.4 human [Q4ZJI4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSL9B1_HUMAN
AccessioniPrimary (citable) accession number: Q4ZJI4
Secondary accession number(s): A1KXV1
, B9EH04, C9JBP7, Q49A30, Q8NCV2, Q8WVZ0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 18, 2010
Last modified: April 25, 2018
This is version 114 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health