Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium/hydrogen exchanger 9B1

Gene

SLC9B1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiR-HSA-2672351. Stimuli-sensing channels.

Protein family/group databases

TCDBi2.A.36.2.3. the monovalent cation:proton antiporter-1 (cpa1) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium/hydrogen exchanger 9B1
Alternative name(s):
Na(+)/H(+) exchanger-like domain-containing protein 1
Short name:
NHE domain-containing protein 1
Sodium/hydrogen exchanger-like domain-containing protein 1
Solute carrier family 9 subfamily B member 1
Gene namesi
Name:SLC9B1
Synonyms:NHEDC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:24244. SLC9B1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei66 – 8621HelicalSequence analysisAdd
BLAST
Transmembranei95 – 11521HelicalSequence analysisAdd
BLAST
Transmembranei116 – 13621HelicalSequence analysisAdd
BLAST
Transmembranei152 – 17221HelicalSequence analysisAdd
BLAST
Transmembranei187 – 20721HelicalSequence analysisAdd
BLAST
Transmembranei215 – 23521HelicalSequence analysisAdd
BLAST
Transmembranei260 – 28021HelicalSequence analysisAdd
BLAST
Transmembranei284 – 30421HelicalSequence analysisAdd
BLAST
Transmembranei337 – 35721HelicalSequence analysisAdd
BLAST
Transmembranei368 – 38821HelicalSequence analysisAdd
BLAST
Transmembranei407 – 42721HelicalSequence analysisAdd
BLAST
Transmembranei431 – 45121HelicalSequence analysisAdd
BLAST
Transmembranei472 – 49221HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162397486.

Polymorphism and mutation databases

BioMutaiSLC9B1.
DMDMi296439240.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 515515Sodium/hydrogen exchanger 9B1PRO_0000314007Add
BLAST

Proteomic databases

PaxDbiQ4ZJI4.
PeptideAtlasiQ4ZJI4.
PRIDEiQ4ZJI4.

PTM databases

iPTMnetiQ4ZJI4.
PhosphoSiteiQ4ZJI4.

Expressioni

Tissue specificityi

Expressed only in the testis.1 Publication

Gene expression databases

BgeeiENSG00000164037.
CleanExiHS_NHEDC1.
ExpressionAtlasiQ4ZJI4. baseline and differential.
GenevisibleiQ4ZJI4. HS.

Organism-specific databases

HPAiHPA035435.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000296422.

Structurei

3D structure databases

ProteinModelPortaliQ4ZJI4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3826. Eukaryota.
COG0025. LUCA.
GeneTreeiENSGT00390000013285.
HOVERGENiHBG108184.
InParanoidiQ4ZJI4.
OMAiPCLMEAC.
OrthoDBiEOG091G06PH.
PhylomeDBiQ4ZJI4.
TreeFamiTF319087.

Family and domain databases

InterProiIPR006153. Cation/H_exchanger.
[Graphical view]
PfamiPF00999. Na_H_Exchanger. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q4ZJI4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHTTESKNEH LEDENFQTST TPQSLIDPNN TAQEETKTVL SDTEEIKPQT
60 70 80 90 100
KKETYISCPL RGVLNVIITN GVILFVIWCM TWSILGSEAL PGGNLFGLFI
110 120 130 140 150
IFYSAIIGGK ILQLIRIPLV PPLPPLLGML LAGFTIRNVP FINEHVHVPN
160 170 180 190 200
TWSSILRSIA LTIILIRAGL GLDPQALRHL KVVCFRLAVG PCLMEASAAA
210 220 230 240 250
VFSHFIMKFP WQWAFLLGFV LGAVSPAVVV PYMMVLQENG YGVEEGIPTL
260 270 280 290 300
LMAASSMDDI LAITGFNTCL SIVFSSGGIL NNAIASIRNV CISLLAGIVL
310 320 330 340 350
GFFVRYFPSE DQKKLTLKRG FLVLTMCVSA VLGSQRIGLH GSGGLCTLVL
360 370 380 390 400
SFIAGTKWSQ EKMKVQKIIT TVWDIFQPLL FGLVGAEVSV SSLESNIVGI
410 420 430 440 450
SVATLSLALC VRILTTYLLM CFAGFSFKEK IFIALAWMPK ATVQAVLGPL
460 470 480 490 500
ALETARVSAP HLEPYAKDVM TVAFLAILIT APNGALLMGI LGPKMLTRHY
510
DPSKIKLQLS TLEHH
Length:515
Mass (Da):56,054
Last modified:May 18, 2010 - v2
Checksum:i37E89E22A8A910E5
GO
Isoform 2 (identifier: Q4ZJI4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: Missing.
     445-515: AVLGPLALET...KLQLSTLEHH → INQAILLLFLLREEWTNCKVAKKCEYTKERQ

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:243
Mass (Da):26,597
Checksum:i83F25B421DC4F400
GO
Isoform 3 (identifier: Q4ZJI4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     445-515: AVLGPLALET...KLQLSTLEHH → INQAILLLFLLREEWTNCKVAKKCEYTKERQ

Show »
Length:475
Mass (Da):52,180
Checksum:iD14FDA43C7F7CD44
GO
Isoform 4 (identifier: Q4ZJI4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-73: GVI → VLF
     74-515: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:73
Mass (Da):8,292
Checksum:i97A79AA3E2575845
GO

Sequence cautioni

The sequence AAM22868 differs from that shown. Reason: Frameshift at positions 219, 298 and 381. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti292 – 2921I → T in AAS91021 (Ref. 3) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti33 – 331Q → H.5 Publications
Corresponds to variant rs2715591 [ dbSNP | Ensembl ].
VAR_061370

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 232232Missing in isoform 2. 1 PublicationVSP_030175Add
BLAST
Alternative sequencei71 – 733GVI → VLF in isoform 4. 1 PublicationVSP_030176
Alternative sequencei74 – 515442Missing in isoform 4. 1 PublicationVSP_030177Add
BLAST
Alternative sequencei445 – 51571AVLGP…TLEHH → INQAILLLFLLREEWTNCKV AKKCEYTKERQ in isoform 2 and isoform 3. 2 PublicationsVSP_030180Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ003059 mRNA. Translation: AAY21808.1.
AF447585 mRNA. Translation: AAM22868.1. Frameshift.
AY461581 mRNA. Translation: AAS91021.1.
AC018797 Genomic DNA. No translation available.
AC083826 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06152.1.
BC022079 mRNA. No translation available.
BC046636 mRNA. No translation available.
BC110794 mRNA. Translation: AAI10795.1.
BC132712 mRNA. Translation: AAI32713.1.
BC136966 mRNA. Translation: AAI36967.1.
CCDSiCCDS34041.1. [Q4ZJI4-1]
CCDS47119.1. [Q4ZJI4-3]
RefSeqiNP_001094344.1. NM_001100874.2.
NP_631912.2. NM_139173.3.
XP_006714156.1. XM_006714093.3. [Q4ZJI4-1]
XP_011529924.1. XM_011531622.1. [Q4ZJI4-1]
XP_011529925.1. XM_011531623.1. [Q4ZJI4-1]
UniGeneiHs.666728.

Genome annotation databases

EnsembliENST00000296422; ENSP00000296422; ENSG00000164037. [Q4ZJI4-1]
ENST00000394789; ENSP00000378269; ENSG00000164037. [Q4ZJI4-3]
ENST00000503584; ENSP00000426926; ENSG00000164037. [Q4ZJI4-5]
ENST00000510243; ENSP00000425913; ENSG00000164037. [Q4ZJI4-5]
GeneIDi150159.
KEGGihsa:150159.
UCSCiuc003hwu.4. human. [Q4ZJI4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ003059 mRNA. Translation: AAY21808.1.
AF447585 mRNA. Translation: AAM22868.1. Frameshift.
AY461581 mRNA. Translation: AAS91021.1.
AC018797 Genomic DNA. No translation available.
AC083826 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06152.1.
BC022079 mRNA. No translation available.
BC046636 mRNA. No translation available.
BC110794 mRNA. Translation: AAI10795.1.
BC132712 mRNA. Translation: AAI32713.1.
BC136966 mRNA. Translation: AAI36967.1.
CCDSiCCDS34041.1. [Q4ZJI4-1]
CCDS47119.1. [Q4ZJI4-3]
RefSeqiNP_001094344.1. NM_001100874.2.
NP_631912.2. NM_139173.3.
XP_006714156.1. XM_006714093.3. [Q4ZJI4-1]
XP_011529924.1. XM_011531622.1. [Q4ZJI4-1]
XP_011529925.1. XM_011531623.1. [Q4ZJI4-1]
UniGeneiHs.666728.

3D structure databases

ProteinModelPortaliQ4ZJI4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000296422.

Protein family/group databases

TCDBi2.A.36.2.3. the monovalent cation:proton antiporter-1 (cpa1) family.

PTM databases

iPTMnetiQ4ZJI4.
PhosphoSiteiQ4ZJI4.

Polymorphism and mutation databases

BioMutaiSLC9B1.
DMDMi296439240.

Proteomic databases

PaxDbiQ4ZJI4.
PeptideAtlasiQ4ZJI4.
PRIDEiQ4ZJI4.

Protocols and materials databases

DNASUi150159.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296422; ENSP00000296422; ENSG00000164037. [Q4ZJI4-1]
ENST00000394789; ENSP00000378269; ENSG00000164037. [Q4ZJI4-3]
ENST00000503584; ENSP00000426926; ENSG00000164037. [Q4ZJI4-5]
ENST00000510243; ENSP00000425913; ENSG00000164037. [Q4ZJI4-5]
GeneIDi150159.
KEGGihsa:150159.
UCSCiuc003hwu.4. human. [Q4ZJI4-1]

Organism-specific databases

CTDi150159.
GeneCardsiSLC9B1.
HGNCiHGNC:24244. SLC9B1.
HPAiHPA035435.
MIMi611527. gene.
neXtProtiNX_Q4ZJI4.
PharmGKBiPA162397486.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3826. Eukaryota.
COG0025. LUCA.
GeneTreeiENSGT00390000013285.
HOVERGENiHBG108184.
InParanoidiQ4ZJI4.
OMAiPCLMEAC.
OrthoDBiEOG091G06PH.
PhylomeDBiQ4ZJI4.
TreeFamiTF319087.

Enzyme and pathway databases

ReactomeiR-HSA-2672351. Stimuli-sensing channels.

Miscellaneous databases

ChiTaRSiSLC9B1. human.
GenomeRNAii150159.
PROiQ4ZJI4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000164037.
CleanExiHS_NHEDC1.
ExpressionAtlasiQ4ZJI4. baseline and differential.
GenevisibleiQ4ZJI4. HS.

Family and domain databases

InterProiIPR006153. Cation/H_exchanger.
[Graphical view]
PfamiPF00999. Na_H_Exchanger. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSL9B1_HUMAN
AccessioniPrimary (citable) accession number: Q4ZJI4
Secondary accession number(s): A1KXV1
, B9EH04, C9JBP7, Q49A30, Q8NCV2, Q8WVZ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 18, 2010
Last modified: September 7, 2016
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.