Q4ZHG4 (FNDC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 73.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fibronectin type III domain-containing protein 1 Alternative name(s): Activation-associated cDNA protein Expressed in synovial lining protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1894 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be an activator of G protein signaling By similarity. |
| Subcellular location | Secreted Potential. |
| Tissue specificity | Almost absent from healthy skin; especially in epidermal keratinocytes, skin fibroblasts or endothelial cells and is barely detectable in benign melanocytic naevi. Expressed in the stroma close to skin tumors, in the tumor cells themselves and in the epidermis of psoriasis. |
| Induction | By TGFB1 present in the melanoma cell conditioned medium (MCCM). Ref.6 |
| Sequence similarities | Contains 5 fibronectin type-III domains. |
| Caution | It is uncertain whether Met-1 or Met-53 is the initiator. |
| Sequence caution | The sequence AAI46784.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAI50608.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAY26234.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAE51894.1 differs from that shown. Reason: Frameshift at position 1487. The sequence CAX14958.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Signal |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cellular response to hypoxia Inferred from electronic annotation. Source: Compara positive regulation of cardiac muscle cell apoptotic processInferred from electronic annotation. Source: Compara positive regulation of protein phosphorylationInferred from electronic annotation. Source: Compara regulation of protein transportInferred from electronic annotation. Source: Compara |
| Cellular_component | cell-cell junction Inferred from electronic annotation. Source: Compara extracellular regionInferred from electronic annotation. Source: UniProtKB-SubCell mitochondrial membraneInferred from electronic annotation. Source: Compara plasma membraneInferred from electronic annotation. Source: Compara |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q4ZHG4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q4ZHG4-2) The sequence of this isoform differs from the canonical sequence as follows: 394-457: EYILSYAPALKPFGAKSLTYPGDTTSALVDGLQPGERYLFKIRATNRRGLGPHSKAFIVAMPTT → A | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 32 | 32 | Potential | ||||||
| Chain | 33 – 1894 | 1862 | Fibronectin type III domain-containing protein 1 | PRO_0000284831 | |||||
Regions | |||||||||
| Domain | 40 – 129 | 90 | Fibronectin type-III 1 | ||||||
| Domain | 158 – 250 | 93 | Fibronectin type-III 2 | ||||||
| Domain | 259 – 354 | 96 | Fibronectin type-III 3 | ||||||
| Domain | 359 – 453 | 95 | Fibronectin type-III 4 | ||||||
| Domain | 1655 – 1749 | 95 | Fibronectin type-III 5 | ||||||
| Compositional bias | 671 – 773 | 103 | Ser-rich | ||||||
| Compositional bias | 1443 – 1516 | 74 | Thr-rich | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 149 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 1661 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 394 – 457 | 64 | EYILS…AMPTT → A in isoform 2. | VSP_024663 | |||||
| Natural variant | 438 | 1 | T → A. Ref.4 Corresponds to variant rs509648 [ dbSNP | Ensembl ]. | VAR_031826 | |||||
| Natural variant | 463 | 1 | E → Q. Ref.3 Ref.4 Corresponds to variant rs420137 [ dbSNP | Ensembl ]. | VAR_031827 | |||||
| Natural variant | 1003 | 1 | Q → E. Ref.3 Ref.4 Corresponds to variant rs370434 [ dbSNP | Ensembl ]. | VAR_031828 | |||||
| Natural variant | 1180 | 1 | D → E. Ref.3 Ref.4 Corresponds to variant rs420054 [ dbSNP | Ensembl ]. | VAR_031829 | |||||
| Natural variant | 1261 | 1 | L → P. Ref.3 Ref.4 Ref.5 Corresponds to variant rs3003174 [ dbSNP | Ensembl ]. | VAR_031830 | |||||
| Natural variant | 1280 | 1 | Q → R. Ref.3 Ref.4 Ref.5 Corresponds to variant rs2501176 [ dbSNP | Ensembl ]. | VAR_031831 | |||||
| Natural variant | 1479 – 1484 | 6 | Missing. Corresponds to variant rs3842694 [ dbSNP | Ensembl ]. | VAR_063225 | |||||
| Natural variant | 1504 | 1 | T → K. Ref.1 Ref.3 Ref.4 Ref.5 Ref.6 Corresponds to variant rs386360 [ dbSNP | Ensembl ]. | VAR_031832 | |||||
| Natural variant | 1574 | 1 | T → A. Corresponds to variant rs7763726 [ dbSNP | Ensembl ]. | VAR_031833 | |||||
Experimental info | |||||||||
| Sequence conflict | 36 | 1 | S → P in AAY26234. Ref.1 | ||||||
| Sequence conflict | 122 | 1 | P → S in AAI50608. Ref.4 | ||||||
| Sequence conflict | 1295 | 1 | M → K in CAE51894. Ref.6 | ||||||
| Sequence conflict | 1487 | 1 | P → S in CAE51894. Ref.6 | ||||||
| Sequence conflict | 1685 | 1 | D → N in CAE51894. Ref.6 | ||||||
| Sequence conflict | 1894 | 1 | W → G in CAE51894. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Use of differential subtraction method to identify genes that characterize the phenotype of cultured rheumatoid arthritis synoviocytes." Seki T., Selby J., Haupl T., Winchester R. Arthritis Rheum. 41:1356-1364(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS 1479-THR--THR-1484 DEL AND LYS-1504. |
| [2] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O. DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 43-1894 (ISOFORM 2), VARIANTS GLN-463; GLU-1003; GLU-1180; PRO-1261; ARG-1280; 1479-THR--THR-1484 DEL AND LYS-1504. Tissue: Brain. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 43-1894 (ISOFORMS 1 AND 2), VARIANTS ALA-438; GLN-463; GLU-1003; GLU-1180; PRO-1261; ARG-1280; 1479-THR--THR-1484 DEL AND LYS-1504. Tissue: Testis. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1196-1894 (ISOFORM 1), VARIANTS PRO-1261; ARG-1280; 1479-THR--THR-1484 DEL AND LYS-1504. Tissue: Lymph node. |
| [6] | "MEL4B3, a novel mRNA is induced in skin tumors and regulated by TGF-beta and pro-inflammatory cytokines." Anderegg U., Breitschwerdt K., Koehler M.J., Sticherling M., Haustein U.-F., Simon J.C., Saalbach A. Exp. Dermatol. 14:709-718(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1295-1894 (ISOFORM 1), INDUCTION BY TGFB1, VARIANTS 1479-THR--THR-1484 DEL AND LYS-1504. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | DQ009660 mRNA. Translation: AAY26234.1. Different initiation. AL355492, AL590551 Genomic DNA. Translation: CAX14958.1. Sequence problems. AL355492, AL356417, AL590551 Genomic DNA. Translation: CAX14959.1. AL356417, AL355492, AL590551 Genomic DNA. Translation: CAX14843.1. AB058769 mRNA. Translation: BAB47495.2. BC146783 mRNA. Translation: AAI46784.1. Different initiation. BC150607 mRNA. Translation: AAI50608.1. Different initiation. AL832410 mRNA. Translation: CAI46178.2. AJ586132 mRNA. Translation: CAE51894.1. Frameshift. |
| IPI | IPI00306457. IPI00844416. |
| RefSeq | NP_115921.2. NM_032532.2. |
| UniGene | Hs.520525. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1UEM based on UniProtKB Q9HCK4. |
| ProteinModelPortal | Q4ZHG4. |
| SMR | Q4ZHG4. Positions 38-123, 263-455, 1652-1821. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000297267. |
PTM databases | |
| PhosphoSite | Q4ZHG4. |
Polymorphism databases | |
| DMDM | 298286926. |
Proteomic databases | |
| PaxDb | Q4ZHG4. |
| PeptideAtlas | Q4ZHG4. |
| PRIDE | Q4ZHG4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000297267; ENSP00000297267; ENSG00000164694. ENST00000340366; ENSP00000342460; ENSG00000164694. |
| GeneID | 84624. |
| KEGG | hsa:84624. |
| UCSC | uc010kjv.3. human. uc010kjw.1. human. |
Organism-specific databases | |
| CTD | 84624. |
| GeneCards | GC06P159590. |
| H-InvDB | HIX0006338. |
| HGNC | HGNC:21184. FNDC1. |
| HPA | HPA030962. |
| MIM | 609991. gene. |
| neXtProt | NX_Q4ZHG4. |
| PharmGKB | PA134906656. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG326991. |
| HOVERGEN | HBG107924. |
| InParanoid | Q4ZHG4. |
| OMA | RYLFKIR. |
| OrthoDB | EOG4Z62MT. |
Gene expression databases | |
| Bgee | Q4ZHG4. |
| CleanEx | HS_FNDC1. |
| Genevestigator | Q4ZHG4. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 5 hits. |
| InterPro | IPR003961. Fibronectin_type3. IPR013783. Ig-like_fold. [Graphical view] |
| Pfam | PF00041. fn3. 4 hits. [Graphical view] |
| SMART | SM00060. FN3. 5 hits. [Graphical view] |
| SUPFAM | SSF49265. FN_III-like. 5 hits. |
| PROSITE | PS50853. FN3. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 84624. |
| NextBio | 74520. |
| SOURCE | Search... |
Entry information
| Entry name | FNDC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q4ZHG4 Secondary accession number(s): A6H8X2 Q96JG1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
