Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q4ZHG4

- FNDC1_HUMAN

UniProt

Q4ZHG4 - FNDC1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Fibronectin type III domain-containing protein 1

Gene

FNDC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May be an activator of G protein signaling.By similarity

GO - Biological processi

  1. cellular response to hypoxia Source: Ensembl
  2. positive regulation of cardiac muscle cell apoptotic process Source: Ensembl
  3. positive regulation of protein phosphorylation Source: Ensembl
  4. regulation of protein transport Source: Ensembl
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Fibronectin type III domain-containing protein 1
Alternative name(s):
Activation-associated cDNA protein
Expressed in synovial lining protein
Gene namesi
Name:FNDC1
Synonyms:FNDC2, KIAA1866, MEL4B3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:21184. FNDC1.

Subcellular locationi

Secreted Curated

GO - Cellular componenti

  1. cell-cell junction Source: Ensembl
  2. extracellular region Source: UniProtKB-KW
  3. mitochondrial membrane Source: Ensembl
  4. nucleus Source: HPA
  5. plasma membrane Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134906656.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3232Sequence AnalysisAdd
BLAST
Chaini33 – 18941862Fibronectin type III domain-containing protein 1PRO_0000284831Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi149 – 1491N-linked (GlcNAc...)Sequence Analysis
Modified residuei717 – 7171PhosphoserineBy similarity
Glycosylationi1661 – 16611N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ4ZHG4.
PeptideAtlasiQ4ZHG4.
PRIDEiQ4ZHG4.

PTM databases

PhosphoSiteiQ4ZHG4.

Expressioni

Tissue specificityi

Almost absent from healthy skin; especially in epidermal keratinocytes, skin fibroblasts or endothelial cells and is barely detectable in benign melanocytic naevi. Expressed in the stroma close to skin tumors, in the tumor cells themselves and in the epidermis of psoriasis.

Inductioni

By TGFB1 present in the melanoma cell conditioned medium (MCCM).1 Publication

Gene expression databases

BgeeiQ4ZHG4.
CleanExiHS_FNDC1.
GenevestigatoriQ4ZHG4.

Organism-specific databases

HPAiHPA030962.
HPA030963.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000297267.

Structurei

3D structure databases

ProteinModelPortaliQ4ZHG4.
SMRiQ4ZHG4. Positions 38-123, 154-455, 1652-1749.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini39 – 13193Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini158 – 258101Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST
Domaini262 – 35796Fibronectin type-III 3PROSITE-ProRule annotationAdd
BLAST
Domaini362 – 45796Fibronectin type-III 4PROSITE-ProRule annotationAdd
BLAST
Domaini1658 – 175295Fibronectin type-III 5PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi671 – 773103Ser-richAdd
BLAST
Compositional biasi1443 – 151674Thr-richAdd
BLAST

Sequence similaritiesi

Contains 5 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

eggNOGiNOG326991.
GeneTreeiENSGT00530000063558.
HOVERGENiHBG107924.
InParanoidiQ4ZHG4.
OMAiNLNVWPV.
OrthoDBiEOG7MH0XD.
PhylomeDBiQ4ZHG4.
TreeFamiTF337588.

Family and domain databases

Gene3Di2.60.40.10. 5 hits.
InterProiIPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
[Graphical view]
PfamiPF00041. fn3. 4 hits.
[Graphical view]
SMARTiSM00060. FN3. 5 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 3 hits.
PROSITEiPS50853. FN3. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q4ZHG4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPEAGATLR APRRLSWAAL LLLAALLPVA SSAAASVDHP LKPRHVKLLS
60 70 80 90 100
TKMGLKVTWD PPKDATSRPV EHYNIAYGKS LKSLKYIKVN AETYSFLIED
110 120 130 140 150
VEPGVVYFVL LTAENHSGVS RPVYRAESPP GGEWIEIDGF PIKGPGPFNE
160 170 180 190 200
TVTEKEVPNK PLRVRVRSSD DRLSVAWKAP RLSGAKSPRR SRGFLLGYGE
210 220 230 240 250
SGRKMNYVPL TRDERTHEIK KLASESVYVV SLQSMNSQGR SQPVYRAALT
260 270 280 290 300
KRKISEEDEL DVPDDISVRV MSSQSVLVSW VDPVLEKQKK VVASRQYTVR
310 320 330 340 350
YREKGELARW DYKQIANRRV LIENLIPDTV YEFAVRISQG ERDGKWSTSV
360 370 380 390 400
FQRTPESAPT TAPENLNVWP VNGKPTVVAA SWDALPETEG KVKEYILSYA
410 420 430 440 450
PALKPFGAKS LTYPGDTTSA LVDGLQPGER YLFKIRATNR RGLGPHSKAF
460 470 480 490 500
IVAMPTTSKA DVEQNTEDNG KPEKPEPSSP SPRAPASSQH PSVPASPQGR
510 520 530 540 550
NAKDLLLDLK NKILANGGAP RKPQLRAKKA EELDLQSTEI TGEEELGSRE
560 570 580 590 600
DSPMSPSDTQ DQKRTLRPPS RHGHSVVAPG RTAVRARMPA LPRREGVDKP
610 620 630 640 650
GFSLATQPRP GAPPSASASP AHHASTQGTS HRPSLPASLN DNDLVDSDED
660 670 680 690 700
ERAVGSLHPK GAFAQPRPAL SPSRQSPSSV LRDRSSVHPG AKPASPARRT
710 720 730 740 750
PHSGAAEEDS SASAPPSRLS PPHGGSSRLL PTQPHLSSPL SKGGKDGEDA
760 770 780 790 800
PATNSNAPSR STMSSSVSSH LSSRTQVSEG AEASDGESHG DGDREDGGRQ
810 820 830 840 850
AEATAQTLRA RPASGHFHLL RHKPFAANGR SPSRFSIGRG PRLQPSSSPQ
860 870 880 890 900
STVPSRAHPR VPSHSDSHPK LSSGIHGDEE DEKPLPATVV NDHVPSSSRQ
910 920 930 940 950
PISRGWEDLR RSPQRGASLH RKEPIPENPK STGADTHPQG KYSSLASKAQ
960 970 980 990 1000
DVQQSTDADT EGHSPKAQPG STDRHASPAR PPAARSQQHP SVPRRMTPGR
1010 1020 1030 1040 1050
APQQQPPPPV ATSQHHPGPQ SRDAGRSPSQ PRLSLTQAGR PRPTSQGRSH
1060 1070 1080 1090 1100
SSSDPYTASS RGMLPTALQN QDEDAQGSYD DDSTEVEAQD VRAPAHAARA
1110 1120 1130 1140 1150
KEAAASLPKH QQVESPTGAG AGGDHRSQRG HAASPARPSR PGGPQSRARV
1160 1170 1180 1190 1200
PSRAAPGKSE PPSKRPLSSK SQQSVSAEDD EEEDAGFFKG GKEDLLSSSV
1210 1220 1230 1240 1250
PKWPSSSTPR GGKDADGSLA KEEREPAIAL APRGGSLAPV KRPLPPPPGS
1260 1270 1280 1290 1300
SPRASHVPSR LPPRSAATVS PVAGTHPWPQ YTTRAPPGHF STTPMLSLRQ
1310 1320 1330 1340 1350
RMMHARFRNP LSRQPARPSY RQGYNGRPNV EGKVLPGSNG KPNGQRIING
1360 1370 1380 1390 1400
PQGTKWVVDL DRGLVLNAEG RYLQDSHGNP LRIKLGGDGR TIVDLEGTPV
1410 1420 1430 1440 1450
VSPDGLPLFG QGRHGTPLAN AQDKPILSLG GKPLVGLEVI KKTTHPPTTT
1460 1470 1480 1490 1500
MQPTTTTTPL PTTTTPRPTT ATTRRTTTTR RTTTRRPTTT VRTTTRTTTT
1510 1520 1530 1540 1550
TTPTPTTPIP TCPPGTLERH DDDGNLIMSS NGIPECYAEE DEFSGLETDT
1560 1570 1580 1590 1600
AVPTEEAYVI YDEDYEFETS RPPTTTEPST TATTPRVIPE EGAISSFPEE
1610 1620 1630 1640 1650
EFDLAGRKRF VAPYVTYLNK DPSAPCSLTD ALDHFQVDSL DEIIPNDLKK
1660 1670 1680 1690 1700
SDLPPQHAPR NITVVAVEGC HSFVIVDWDK ATPGDVVTGY LVYSASYEDF
1710 1720 1730 1740 1750
IRNKWSTQAS SVTHLPIENL KPNTRYYFKV QAQNPHGYGP ISPSVSFVTE
1760 1770 1780 1790 1800
SDNPLLVVRP PGGEPIWIPF AFKHDPSYTD CHGRQYVKRT WYRKFVGVVL
1810 1820 1830 1840 1850
CNSLRYKIYL SDNLKDTFYS IGDSWGRGED HCQFVDSHLD GRTGPQSYVE
1860 1870 1880 1890
ALPTIQGYYR QYRQEPVRFG NIGFGTPYYY VGWYECGVSI PGKW
Length:1,894
Mass (Da):205,558
Last modified:June 15, 2010 - v4
Checksum:i7A0A9D0445E511D8
GO
Isoform 2 (identifier: Q4ZHG4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-457: EYILSYAPALKPFGAKSLTYPGDTTSALVDGLQPGERYLFKIRATNRRGLGPHSKAFIVAMPTT → A

Note: No experimental confirmation available.

Show »
Length:1,831
Mass (Da):198,691
Checksum:iF45306BBA0BE0010
GO

Sequence cautioni

The sequence AAI46784.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI50608.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAY26234.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAE51894.1 differs from that shown. Reason: Frameshift at position 1487. Curated
The sequence CAX14958.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti36 – 361S → P in AAY26234. (PubMed:9704633)Curated
Sequence conflicti122 – 1221P → S in AAI50608. (PubMed:15489334)Curated
Sequence conflicti1295 – 12951M → K in CAE51894. (PubMed:16098131)Curated
Sequence conflicti1487 – 14871P → S in CAE51894. (PubMed:16098131)Curated
Sequence conflicti1685 – 16851D → N in CAE51894. (PubMed:16098131)Curated
Sequence conflicti1894 – 18941W → G in CAE51894. (PubMed:16098131)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti438 – 4381T → A.1 Publication
Corresponds to variant rs509648 [ dbSNP | Ensembl ].
VAR_031826
Natural varianti463 – 4631E → Q.2 Publications
Corresponds to variant rs420137 [ dbSNP | Ensembl ].
VAR_031827
Natural varianti1003 – 10031Q → E.2 Publications
Corresponds to variant rs370434 [ dbSNP | Ensembl ].
VAR_031828
Natural varianti1180 – 11801D → E.2 Publications
Corresponds to variant rs420054 [ dbSNP | Ensembl ].
VAR_031829
Natural varianti1261 – 12611L → P.3 Publications
Corresponds to variant rs3003174 [ dbSNP | Ensembl ].
VAR_031830
Natural varianti1280 – 12801Q → R.3 Publications
Corresponds to variant rs2501176 [ dbSNP | Ensembl ].
VAR_031831
Natural varianti1479 – 14846Missing.5 Publications
Corresponds to variant rs3842694 [ dbSNP | Ensembl ].
VAR_063225
Natural varianti1504 – 15041T → K.5 Publications
Corresponds to variant rs386360 [ dbSNP | Ensembl ].
VAR_031832
Natural varianti1574 – 15741T → A.
Corresponds to variant rs7763726 [ dbSNP | Ensembl ].
VAR_031833

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei394 – 45764EYILS…AMPTT → A in isoform 2. 2 PublicationsVSP_024663Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ009660 mRNA. Translation: AAY26234.1. Different initiation.
AL355492, AL590551 Genomic DNA. Translation: CAX14958.1. Sequence problems.
AL355492, AL356417, AL590551 Genomic DNA. Translation: CAX14959.1.
AL356417, AL355492, AL590551 Genomic DNA. Translation: CAX14843.1.
AB058769 mRNA. Translation: BAB47495.2.
BC146783 mRNA. Translation: AAI46784.1. Different initiation.
BC150607 mRNA. Translation: AAI50608.1. Different initiation.
AL832410 mRNA. Translation: CAI46178.2.
AJ586132 mRNA. Translation: CAE51894.1. Frameshift.
CCDSiCCDS47512.1. [Q4ZHG4-1]
RefSeqiNP_115921.2. NM_032532.2. [Q4ZHG4-1]
UniGeneiHs.520525.

Genome annotation databases

EnsembliENST00000297267; ENSP00000297267; ENSG00000164694. [Q4ZHG4-1]
GeneIDi84624.
KEGGihsa:84624.
UCSCiuc010kjv.3. human. [Q4ZHG4-1]

Polymorphism databases

DMDMi298286926.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ009660 mRNA. Translation: AAY26234.1 . Different initiation.
AL355492 , AL590551 Genomic DNA. Translation: CAX14958.1 . Sequence problems.
AL355492 , AL356417 , AL590551 Genomic DNA. Translation: CAX14959.1 .
AL356417 , AL355492 , AL590551 Genomic DNA. Translation: CAX14843.1 .
AB058769 mRNA. Translation: BAB47495.2 .
BC146783 mRNA. Translation: AAI46784.1 . Different initiation.
BC150607 mRNA. Translation: AAI50608.1 . Different initiation.
AL832410 mRNA. Translation: CAI46178.2 .
AJ586132 mRNA. Translation: CAE51894.1 . Frameshift.
CCDSi CCDS47512.1. [Q4ZHG4-1 ]
RefSeqi NP_115921.2. NM_032532.2. [Q4ZHG4-1 ]
UniGenei Hs.520525.

3D structure databases

ProteinModelPortali Q4ZHG4.
SMRi Q4ZHG4. Positions 38-123, 154-455, 1652-1749.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000297267.

PTM databases

PhosphoSitei Q4ZHG4.

Polymorphism databases

DMDMi 298286926.

Proteomic databases

PaxDbi Q4ZHG4.
PeptideAtlasi Q4ZHG4.
PRIDEi Q4ZHG4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000297267 ; ENSP00000297267 ; ENSG00000164694 . [Q4ZHG4-1 ]
GeneIDi 84624.
KEGGi hsa:84624.
UCSCi uc010kjv.3. human. [Q4ZHG4-1 ]

Organism-specific databases

CTDi 84624.
GeneCardsi GC06P159590.
H-InvDB HIX0006338.
HGNCi HGNC:21184. FNDC1.
HPAi HPA030962.
HPA030963.
MIMi 609991. gene.
neXtProti NX_Q4ZHG4.
PharmGKBi PA134906656.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG326991.
GeneTreei ENSGT00530000063558.
HOVERGENi HBG107924.
InParanoidi Q4ZHG4.
OMAi NLNVWPV.
OrthoDBi EOG7MH0XD.
PhylomeDBi Q4ZHG4.
TreeFami TF337588.

Miscellaneous databases

GenomeRNAii 84624.
NextBioi 74520.
PROi Q4ZHG4.
SOURCEi Search...

Gene expression databases

Bgeei Q4ZHG4.
CleanExi HS_FNDC1.
Genevestigatori Q4ZHG4.

Family and domain databases

Gene3Di 2.60.40.10. 5 hits.
InterProi IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
[Graphical view ]
Pfami PF00041. fn3. 4 hits.
[Graphical view ]
SMARTi SM00060. FN3. 5 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 3 hits.
PROSITEi PS50853. FN3. 5 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Use of differential subtraction method to identify genes that characterize the phenotype of cultured rheumatoid arthritis synoviocytes."
    Seki T., Selby J., Haupl T., Winchester R.
    Arthritis Rheum. 41:1356-1364(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS 1479-THR--THR-1484 DEL AND LYS-1504.
  2. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
    DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 43-1894 (ISOFORM 2), VARIANTS GLN-463; GLU-1003; GLU-1180; PRO-1261; ARG-1280; 1479-THR--THR-1484 DEL AND LYS-1504.
    Tissue: Brain.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 43-1894 (ISOFORMS 1 AND 2), VARIANTS ALA-438; GLN-463; GLU-1003; GLU-1180; PRO-1261; ARG-1280; 1479-THR--THR-1484 DEL AND LYS-1504.
    Tissue: Testis.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1196-1894 (ISOFORM 1), VARIANTS PRO-1261; ARG-1280; 1479-THR--THR-1484 DEL AND LYS-1504.
    Tissue: Lymph node.
  6. "MEL4B3, a novel mRNA is induced in skin tumors and regulated by TGF-beta and pro-inflammatory cytokines."
    Anderegg U., Breitschwerdt K., Koehler M.J., Sticherling M., Haustein U.-F., Simon J.C., Saalbach A.
    Exp. Dermatol. 14:709-718(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1295-1894 (ISOFORM 1), INDUCTION BY TGFB1, VARIANTS 1479-THR--THR-1484 DEL AND LYS-1504.

Entry informationi

Entry nameiFNDC1_HUMAN
AccessioniPrimary (citable) accession number: Q4ZHG4
Secondary accession number(s): A6H8X2
, B7ZBR4, B7ZBR5, B9EK49, Q5JPI0, Q5VU31, Q5VU32, Q5VXX4, Q70CQ6, Q96JG1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: June 15, 2010
Last modified: November 26, 2014
This is version 89 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3