Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q4ZHG4 (FNDC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 83. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Fibronectin type III domain-containing protein 1
Alternative name(s):
Activation-associated cDNA protein
Expressed in synovial lining protein
Gene names
Name:FNDC1
Synonyms:FNDC2, KIAA1866, MEL4B3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1894 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be an activator of G protein signaling By similarity.

Subcellular location

Secreted Potential.

Tissue specificity

Almost absent from healthy skin; especially in epidermal keratinocytes, skin fibroblasts or endothelial cells and is barely detectable in benign melanocytic naevi. Expressed in the stroma close to skin tumors, in the tumor cells themselves and in the epidermis of psoriasis.

Induction

By TGFB1 present in the melanoma cell conditioned medium (MCCM). Ref.6

Sequence similarities

Contains 5 fibronectin type-III domains.

Caution

It is uncertain whether Met-1 or Met-53 is the initiator.

Sequence caution

The sequence AAI46784.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAI50608.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAY26234.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence CAE51894.1 differs from that shown. Reason: Frameshift at position 1487.

The sequence CAX14958.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q4ZHG4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q4ZHG4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     394-457: EYILSYAPALKPFGAKSLTYPGDTTSALVDGLQPGERYLFKIRATNRRGLGPHSKAFIVAMPTT → A
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3232 Potential
Chain33 – 18941862Fibronectin type III domain-containing protein 1
PRO_0000284831

Regions

Domain39 – 13193Fibronectin type-III 1
Domain158 – 258101Fibronectin type-III 2
Domain262 – 35796Fibronectin type-III 3
Domain362 – 45796Fibronectin type-III 4
Domain1658 – 175295Fibronectin type-III 5
Compositional bias671 – 773103Ser-rich
Compositional bias1443 – 151674Thr-rich

Amino acid modifications

Modified residue7171Phosphoserine By similarity
Glycosylation1491N-linked (GlcNAc...) Potential
Glycosylation16611N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence394 – 45764EYILS…AMPTT → A in isoform 2.
VSP_024663
Natural variant4381T → A. Ref.4
Corresponds to variant rs509648 [ dbSNP | Ensembl ].
VAR_031826
Natural variant4631E → Q. Ref.3 Ref.4
Corresponds to variant rs420137 [ dbSNP | Ensembl ].
VAR_031827
Natural variant10031Q → E. Ref.3 Ref.4
Corresponds to variant rs370434 [ dbSNP | Ensembl ].
VAR_031828
Natural variant11801D → E. Ref.3 Ref.4
Corresponds to variant rs420054 [ dbSNP | Ensembl ].
VAR_031829
Natural variant12611L → P. Ref.3 Ref.4 Ref.5
Corresponds to variant rs3003174 [ dbSNP | Ensembl ].
VAR_031830
Natural variant12801Q → R. Ref.3 Ref.4 Ref.5
Corresponds to variant rs2501176 [ dbSNP | Ensembl ].
VAR_031831
Natural variant1479 – 14846Missing.
Corresponds to variant rs3842694 [ dbSNP | Ensembl ].
VAR_063225
Natural variant15041T → K. Ref.1 Ref.3 Ref.4 Ref.5 Ref.6
Corresponds to variant rs386360 [ dbSNP | Ensembl ].
VAR_031832
Natural variant15741T → A.
Corresponds to variant rs7763726 [ dbSNP | Ensembl ].
VAR_031833

Experimental info

Sequence conflict361S → P in AAY26234. Ref.1
Sequence conflict1221P → S in AAI50608. Ref.4
Sequence conflict12951M → K in CAE51894. Ref.6
Sequence conflict14871P → S in CAE51894. Ref.6
Sequence conflict16851D → N in CAE51894. Ref.6
Sequence conflict18941W → G in CAE51894. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 15, 2010. Version 4.
Checksum: 7A0A9D0445E511D8

FASTA1,894205,558
        10         20         30         40         50         60 
MAPEAGATLR APRRLSWAAL LLLAALLPVA SSAAASVDHP LKPRHVKLLS TKMGLKVTWD 

        70         80         90        100        110        120 
PPKDATSRPV EHYNIAYGKS LKSLKYIKVN AETYSFLIED VEPGVVYFVL LTAENHSGVS 

       130        140        150        160        170        180 
RPVYRAESPP GGEWIEIDGF PIKGPGPFNE TVTEKEVPNK PLRVRVRSSD DRLSVAWKAP 

       190        200        210        220        230        240 
RLSGAKSPRR SRGFLLGYGE SGRKMNYVPL TRDERTHEIK KLASESVYVV SLQSMNSQGR 

       250        260        270        280        290        300 
SQPVYRAALT KRKISEEDEL DVPDDISVRV MSSQSVLVSW VDPVLEKQKK VVASRQYTVR 

       310        320        330        340        350        360 
YREKGELARW DYKQIANRRV LIENLIPDTV YEFAVRISQG ERDGKWSTSV FQRTPESAPT 

       370        380        390        400        410        420 
TAPENLNVWP VNGKPTVVAA SWDALPETEG KVKEYILSYA PALKPFGAKS LTYPGDTTSA 

       430        440        450        460        470        480 
LVDGLQPGER YLFKIRATNR RGLGPHSKAF IVAMPTTSKA DVEQNTEDNG KPEKPEPSSP 

       490        500        510        520        530        540 
SPRAPASSQH PSVPASPQGR NAKDLLLDLK NKILANGGAP RKPQLRAKKA EELDLQSTEI 

       550        560        570        580        590        600 
TGEEELGSRE DSPMSPSDTQ DQKRTLRPPS RHGHSVVAPG RTAVRARMPA LPRREGVDKP 

       610        620        630        640        650        660 
GFSLATQPRP GAPPSASASP AHHASTQGTS HRPSLPASLN DNDLVDSDED ERAVGSLHPK 

       670        680        690        700        710        720 
GAFAQPRPAL SPSRQSPSSV LRDRSSVHPG AKPASPARRT PHSGAAEEDS SASAPPSRLS 

       730        740        750        760        770        780 
PPHGGSSRLL PTQPHLSSPL SKGGKDGEDA PATNSNAPSR STMSSSVSSH LSSRTQVSEG 

       790        800        810        820        830        840 
AEASDGESHG DGDREDGGRQ AEATAQTLRA RPASGHFHLL RHKPFAANGR SPSRFSIGRG 

       850        860        870        880        890        900 
PRLQPSSSPQ STVPSRAHPR VPSHSDSHPK LSSGIHGDEE DEKPLPATVV NDHVPSSSRQ 

       910        920        930        940        950        960 
PISRGWEDLR RSPQRGASLH RKEPIPENPK STGADTHPQG KYSSLASKAQ DVQQSTDADT 

       970        980        990       1000       1010       1020 
EGHSPKAQPG STDRHASPAR PPAARSQQHP SVPRRMTPGR APQQQPPPPV ATSQHHPGPQ 

      1030       1040       1050       1060       1070       1080 
SRDAGRSPSQ PRLSLTQAGR PRPTSQGRSH SSSDPYTASS RGMLPTALQN QDEDAQGSYD 

      1090       1100       1110       1120       1130       1140 
DDSTEVEAQD VRAPAHAARA KEAAASLPKH QQVESPTGAG AGGDHRSQRG HAASPARPSR 

      1150       1160       1170       1180       1190       1200 
PGGPQSRARV PSRAAPGKSE PPSKRPLSSK SQQSVSAEDD EEEDAGFFKG GKEDLLSSSV 

      1210       1220       1230       1240       1250       1260 
PKWPSSSTPR GGKDADGSLA KEEREPAIAL APRGGSLAPV KRPLPPPPGS SPRASHVPSR 

      1270       1280       1290       1300       1310       1320 
LPPRSAATVS PVAGTHPWPQ YTTRAPPGHF STTPMLSLRQ RMMHARFRNP LSRQPARPSY 

      1330       1340       1350       1360       1370       1380 
RQGYNGRPNV EGKVLPGSNG KPNGQRIING PQGTKWVVDL DRGLVLNAEG RYLQDSHGNP 

      1390       1400       1410       1420       1430       1440 
LRIKLGGDGR TIVDLEGTPV VSPDGLPLFG QGRHGTPLAN AQDKPILSLG GKPLVGLEVI 

      1450       1460       1470       1480       1490       1500 
KKTTHPPTTT MQPTTTTTPL PTTTTPRPTT ATTRRTTTTR RTTTRRPTTT VRTTTRTTTT 

      1510       1520       1530       1540       1550       1560 
TTPTPTTPIP TCPPGTLERH DDDGNLIMSS NGIPECYAEE DEFSGLETDT AVPTEEAYVI 

      1570       1580       1590       1600       1610       1620 
YDEDYEFETS RPPTTTEPST TATTPRVIPE EGAISSFPEE EFDLAGRKRF VAPYVTYLNK 

      1630       1640       1650       1660       1670       1680 
DPSAPCSLTD ALDHFQVDSL DEIIPNDLKK SDLPPQHAPR NITVVAVEGC HSFVIVDWDK 

      1690       1700       1710       1720       1730       1740 
ATPGDVVTGY LVYSASYEDF IRNKWSTQAS SVTHLPIENL KPNTRYYFKV QAQNPHGYGP 

      1750       1760       1770       1780       1790       1800 
ISPSVSFVTE SDNPLLVVRP PGGEPIWIPF AFKHDPSYTD CHGRQYVKRT WYRKFVGVVL 

      1810       1820       1830       1840       1850       1860 
CNSLRYKIYL SDNLKDTFYS IGDSWGRGED HCQFVDSHLD GRTGPQSYVE ALPTIQGYYR 

      1870       1880       1890 
QYRQEPVRFG NIGFGTPYYY VGWYECGVSI PGKW 

« Hide

Isoform 2 [UniParc].

Checksum: F45306BBA0BE0010
Show »

FASTA1,831198,691

References

« Hide 'large scale' references
[1]"Use of differential subtraction method to identify genes that characterize the phenotype of cultured rheumatoid arthritis synoviocytes."
Seki T., Selby J., Haupl T., Winchester R.
Arthritis Rheum. 41:1356-1364(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS 1479-THR--THR-1484 DEL AND LYS-1504.
[2]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 43-1894 (ISOFORM 2), VARIANTS GLN-463; GLU-1003; GLU-1180; PRO-1261; ARG-1280; 1479-THR--THR-1484 DEL AND LYS-1504.
Tissue: Brain.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 43-1894 (ISOFORMS 1 AND 2), VARIANTS ALA-438; GLN-463; GLU-1003; GLU-1180; PRO-1261; ARG-1280; 1479-THR--THR-1484 DEL AND LYS-1504.
Tissue: Testis.
[5]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1196-1894 (ISOFORM 1), VARIANTS PRO-1261; ARG-1280; 1479-THR--THR-1484 DEL AND LYS-1504.
Tissue: Lymph node.
[6]"MEL4B3, a novel mRNA is induced in skin tumors and regulated by TGF-beta and pro-inflammatory cytokines."
Anderegg U., Breitschwerdt K., Koehler M.J., Sticherling M., Haustein U.-F., Simon J.C., Saalbach A.
Exp. Dermatol. 14:709-718(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1295-1894 (ISOFORM 1), INDUCTION BY TGFB1, VARIANTS 1479-THR--THR-1484 DEL AND LYS-1504.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
DQ009660 mRNA. Translation: AAY26234.1. Different initiation.
AL355492, AL590551 Genomic DNA. Translation: CAX14958.1. Sequence problems.
AL355492, AL356417, AL590551 Genomic DNA. Translation: CAX14959.1.
AL356417, AL355492, AL590551 Genomic DNA. Translation: CAX14843.1.
AB058769 mRNA. Translation: BAB47495.2.
BC146783 mRNA. Translation: AAI46784.1. Different initiation.
BC150607 mRNA. Translation: AAI50608.1. Different initiation.
AL832410 mRNA. Translation: CAI46178.2.
AJ586132 mRNA. Translation: CAE51894.1. Frameshift.
RefSeqNP_115921.2. NM_032532.2.
UniGeneHs.520525.

3D structure databases

ProteinModelPortalQ4ZHG4.
SMRQ4ZHG4. Positions 37-253, 263-456, 1652-1749.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000297267.

PTM databases

PhosphoSiteQ4ZHG4.

Polymorphism databases

DMDM298286926.

Proteomic databases

PaxDbQ4ZHG4.
PeptideAtlasQ4ZHG4.
PRIDEQ4ZHG4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000297267; ENSP00000297267; ENSG00000164694. [Q4ZHG4-1]
ENST00000340366; ENSP00000342460; ENSG00000164694. [Q4ZHG4-2]
GeneID84624.
KEGGhsa:84624.
UCSCuc010kjv.3. human. [Q4ZHG4-1]

Organism-specific databases

CTD84624.
GeneCardsGC06P159590.
H-InvDBHIX0006338.
HGNCHGNC:21184. FNDC1.
HPAHPA030962.
HPA030963.
MIM609991. gene.
neXtProtNX_Q4ZHG4.
PharmGKBPA134906656.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG326991.
HOVERGENHBG107924.
InParanoidQ4ZHG4.
OMANLNVWPV.
OrthoDBEOG7MH0XD.
PhylomeDBQ4ZHG4.
TreeFamTF337588.

Gene expression databases

BgeeQ4ZHG4.
CleanExHS_FNDC1.
GenevestigatorQ4ZHG4.

Family and domain databases

Gene3D2.60.40.10. 5 hits.
InterProIPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
[Graphical view]
PfamPF00041. fn3. 4 hits.
[Graphical view]
SMARTSM00060. FN3. 5 hits.
[Graphical view]
SUPFAMSSF49265. SSF49265. 3 hits.
PROSITEPS50853. FN3. 5 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi84624.
NextBio74520.
PROQ4ZHG4.
SOURCESearch...

Entry information

Entry nameFNDC1_HUMAN
AccessionPrimary (citable) accession number: Q4ZHG4
Secondary accession number(s): A6H8X2 expand/collapse secondary AC list , B7ZBR4, B7ZBR5, B9EK49, Q5JPI0, Q5VU31, Q5VU32, Q5VXX4, Q70CQ6, Q96JG1
Entry history
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: June 15, 2010
Last modified: April 16, 2014
This is version 83 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM