Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q4ZHG4

- FNDC1_HUMAN

UniProt

Q4ZHG4 - FNDC1_HUMAN

Protein

Fibronectin type III domain-containing protein 1

Gene

FNDC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 4 (15 Jun 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be an activator of G protein signaling.By similarity

    GO - Biological processi

    1. cellular response to hypoxia Source: Ensembl
    2. positive regulation of cardiac muscle cell apoptotic process Source: Ensembl
    3. positive regulation of protein phosphorylation Source: Ensembl
    4. regulation of protein transport Source: Ensembl

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Fibronectin type III domain-containing protein 1
    Alternative name(s):
    Activation-associated cDNA protein
    Expressed in synovial lining protein
    Gene namesi
    Name:FNDC1
    Synonyms:FNDC2, KIAA1866, MEL4B3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:21184. FNDC1.

    Subcellular locationi

    Secreted Curated

    GO - Cellular componenti

    1. cell-cell junction Source: Ensembl
    2. extracellular region Source: UniProtKB-SubCell
    3. mitochondrial membrane Source: Ensembl
    4. nucleus Source: HPA
    5. plasma membrane Source: Ensembl

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134906656.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3232Sequence AnalysisAdd
    BLAST
    Chaini33 – 18941862Fibronectin type III domain-containing protein 1PRO_0000284831Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi149 – 1491N-linked (GlcNAc...)Sequence Analysis
    Modified residuei717 – 7171PhosphoserineBy similarity
    Glycosylationi1661 – 16611N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ4ZHG4.
    PeptideAtlasiQ4ZHG4.
    PRIDEiQ4ZHG4.

    PTM databases

    PhosphoSiteiQ4ZHG4.

    Expressioni

    Tissue specificityi

    Almost absent from healthy skin; especially in epidermal keratinocytes, skin fibroblasts or endothelial cells and is barely detectable in benign melanocytic naevi. Expressed in the stroma close to skin tumors, in the tumor cells themselves and in the epidermis of psoriasis.

    Inductioni

    By TGFB1 present in the melanoma cell conditioned medium (MCCM).1 Publication

    Gene expression databases

    BgeeiQ4ZHG4.
    CleanExiHS_FNDC1.
    GenevestigatoriQ4ZHG4.

    Organism-specific databases

    HPAiHPA030962.
    HPA030963.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000297267.

    Structurei

    3D structure databases

    ProteinModelPortaliQ4ZHG4.
    SMRiQ4ZHG4. Positions 40-123, 160-245, 263-455, 1652-1749.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini39 – 13193Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini158 – 258101Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini262 – 35796Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini362 – 45796Fibronectin type-III 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini1658 – 175295Fibronectin type-III 5PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi671 – 773103Ser-richAdd
    BLAST
    Compositional biasi1443 – 151674Thr-richAdd
    BLAST

    Sequence similaritiesi

    Contains 5 fibronectin type-III domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal

    Phylogenomic databases

    eggNOGiNOG326991.
    HOVERGENiHBG107924.
    InParanoidiQ4ZHG4.
    OMAiNLNVWPV.
    OrthoDBiEOG7MH0XD.
    PhylomeDBiQ4ZHG4.
    TreeFamiTF337588.

    Family and domain databases

    Gene3Di2.60.40.10. 5 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR013783. Ig-like_fold.
    [Graphical view]
    PfamiPF00041. fn3. 4 hits.
    [Graphical view]
    SMARTiSM00060. FN3. 5 hits.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 3 hits.
    PROSITEiPS50853. FN3. 5 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q4ZHG4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAPEAGATLR APRRLSWAAL LLLAALLPVA SSAAASVDHP LKPRHVKLLS     50
    TKMGLKVTWD PPKDATSRPV EHYNIAYGKS LKSLKYIKVN AETYSFLIED 100
    VEPGVVYFVL LTAENHSGVS RPVYRAESPP GGEWIEIDGF PIKGPGPFNE 150
    TVTEKEVPNK PLRVRVRSSD DRLSVAWKAP RLSGAKSPRR SRGFLLGYGE 200
    SGRKMNYVPL TRDERTHEIK KLASESVYVV SLQSMNSQGR SQPVYRAALT 250
    KRKISEEDEL DVPDDISVRV MSSQSVLVSW VDPVLEKQKK VVASRQYTVR 300
    YREKGELARW DYKQIANRRV LIENLIPDTV YEFAVRISQG ERDGKWSTSV 350
    FQRTPESAPT TAPENLNVWP VNGKPTVVAA SWDALPETEG KVKEYILSYA 400
    PALKPFGAKS LTYPGDTTSA LVDGLQPGER YLFKIRATNR RGLGPHSKAF 450
    IVAMPTTSKA DVEQNTEDNG KPEKPEPSSP SPRAPASSQH PSVPASPQGR 500
    NAKDLLLDLK NKILANGGAP RKPQLRAKKA EELDLQSTEI TGEEELGSRE 550
    DSPMSPSDTQ DQKRTLRPPS RHGHSVVAPG RTAVRARMPA LPRREGVDKP 600
    GFSLATQPRP GAPPSASASP AHHASTQGTS HRPSLPASLN DNDLVDSDED 650
    ERAVGSLHPK GAFAQPRPAL SPSRQSPSSV LRDRSSVHPG AKPASPARRT 700
    PHSGAAEEDS SASAPPSRLS PPHGGSSRLL PTQPHLSSPL SKGGKDGEDA 750
    PATNSNAPSR STMSSSVSSH LSSRTQVSEG AEASDGESHG DGDREDGGRQ 800
    AEATAQTLRA RPASGHFHLL RHKPFAANGR SPSRFSIGRG PRLQPSSSPQ 850
    STVPSRAHPR VPSHSDSHPK LSSGIHGDEE DEKPLPATVV NDHVPSSSRQ 900
    PISRGWEDLR RSPQRGASLH RKEPIPENPK STGADTHPQG KYSSLASKAQ 950
    DVQQSTDADT EGHSPKAQPG STDRHASPAR PPAARSQQHP SVPRRMTPGR 1000
    APQQQPPPPV ATSQHHPGPQ SRDAGRSPSQ PRLSLTQAGR PRPTSQGRSH 1050
    SSSDPYTASS RGMLPTALQN QDEDAQGSYD DDSTEVEAQD VRAPAHAARA 1100
    KEAAASLPKH QQVESPTGAG AGGDHRSQRG HAASPARPSR PGGPQSRARV 1150
    PSRAAPGKSE PPSKRPLSSK SQQSVSAEDD EEEDAGFFKG GKEDLLSSSV 1200
    PKWPSSSTPR GGKDADGSLA KEEREPAIAL APRGGSLAPV KRPLPPPPGS 1250
    SPRASHVPSR LPPRSAATVS PVAGTHPWPQ YTTRAPPGHF STTPMLSLRQ 1300
    RMMHARFRNP LSRQPARPSY RQGYNGRPNV EGKVLPGSNG KPNGQRIING 1350
    PQGTKWVVDL DRGLVLNAEG RYLQDSHGNP LRIKLGGDGR TIVDLEGTPV 1400
    VSPDGLPLFG QGRHGTPLAN AQDKPILSLG GKPLVGLEVI KKTTHPPTTT 1450
    MQPTTTTTPL PTTTTPRPTT ATTRRTTTTR RTTTRRPTTT VRTTTRTTTT 1500
    TTPTPTTPIP TCPPGTLERH DDDGNLIMSS NGIPECYAEE DEFSGLETDT 1550
    AVPTEEAYVI YDEDYEFETS RPPTTTEPST TATTPRVIPE EGAISSFPEE 1600
    EFDLAGRKRF VAPYVTYLNK DPSAPCSLTD ALDHFQVDSL DEIIPNDLKK 1650
    SDLPPQHAPR NITVVAVEGC HSFVIVDWDK ATPGDVVTGY LVYSASYEDF 1700
    IRNKWSTQAS SVTHLPIENL KPNTRYYFKV QAQNPHGYGP ISPSVSFVTE 1750
    SDNPLLVVRP PGGEPIWIPF AFKHDPSYTD CHGRQYVKRT WYRKFVGVVL 1800
    CNSLRYKIYL SDNLKDTFYS IGDSWGRGED HCQFVDSHLD GRTGPQSYVE 1850
    ALPTIQGYYR QYRQEPVRFG NIGFGTPYYY VGWYECGVSI PGKW 1894
    Length:1,894
    Mass (Da):205,558
    Last modified:June 15, 2010 - v4
    Checksum:i7A0A9D0445E511D8
    GO
    Isoform 2 (identifier: Q4ZHG4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         394-457: EYILSYAPALKPFGAKSLTYPGDTTSALVDGLQPGERYLFKIRATNRRGLGPHSKAFIVAMPTT → A

    Note: No experimental confirmation available.

    Show »
    Length:1,831
    Mass (Da):198,691
    Checksum:iF45306BBA0BE0010
    GO

    Sequence cautioni

    The sequence CAE51894.1 differs from that shown. Reason: Frameshift at position 1487.
    The sequence AAI46784.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAI50608.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAY26234.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence CAX14958.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti36 – 361S → P in AAY26234. (PubMed:9704633)Curated
    Sequence conflicti122 – 1221P → S in AAI50608. (PubMed:15489334)Curated
    Sequence conflicti1295 – 12951M → K in CAE51894. (PubMed:16098131)Curated
    Sequence conflicti1487 – 14871P → S in CAE51894. (PubMed:16098131)Curated
    Sequence conflicti1685 – 16851D → N in CAE51894. (PubMed:16098131)Curated
    Sequence conflicti1894 – 18941W → G in CAE51894. (PubMed:16098131)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti438 – 4381T → A.1 Publication
    Corresponds to variant rs509648 [ dbSNP | Ensembl ].
    VAR_031826
    Natural varianti463 – 4631E → Q.2 Publications
    Corresponds to variant rs420137 [ dbSNP | Ensembl ].
    VAR_031827
    Natural varianti1003 – 10031Q → E.2 Publications
    Corresponds to variant rs370434 [ dbSNP | Ensembl ].
    VAR_031828
    Natural varianti1180 – 11801D → E.2 Publications
    Corresponds to variant rs420054 [ dbSNP | Ensembl ].
    VAR_031829
    Natural varianti1261 – 12611L → P.3 Publications
    Corresponds to variant rs3003174 [ dbSNP | Ensembl ].
    VAR_031830
    Natural varianti1280 – 12801Q → R.3 Publications
    Corresponds to variant rs2501176 [ dbSNP | Ensembl ].
    VAR_031831
    Natural varianti1479 – 14846Missing.
    Corresponds to variant rs3842694 [ dbSNP | Ensembl ].
    VAR_063225
    Natural varianti1504 – 15041T → K.5 Publications
    Corresponds to variant rs386360 [ dbSNP | Ensembl ].
    VAR_031832
    Natural varianti1574 – 15741T → A.
    Corresponds to variant rs7763726 [ dbSNP | Ensembl ].
    VAR_031833

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei394 – 45764EYILS…AMPTT → A in isoform 2. 2 PublicationsVSP_024663Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ009660 mRNA. Translation: AAY26234.1. Different initiation.
    AL355492, AL590551 Genomic DNA. Translation: CAX14958.1. Sequence problems.
    AL355492, AL356417, AL590551 Genomic DNA. Translation: CAX14959.1.
    AL356417, AL355492, AL590551 Genomic DNA. Translation: CAX14843.1.
    AB058769 mRNA. Translation: BAB47495.2.
    BC146783 mRNA. Translation: AAI46784.1. Different initiation.
    BC150607 mRNA. Translation: AAI50608.1. Different initiation.
    AL832410 mRNA. Translation: CAI46178.2.
    AJ586132 mRNA. Translation: CAE51894.1. Frameshift.
    CCDSiCCDS47512.1. [Q4ZHG4-1]
    RefSeqiNP_115921.2. NM_032532.2. [Q4ZHG4-1]
    UniGeneiHs.520525.

    Genome annotation databases

    EnsembliENST00000297267; ENSP00000297267; ENSG00000164694. [Q4ZHG4-1]
    GeneIDi84624.
    KEGGihsa:84624.
    UCSCiuc010kjv.3. human. [Q4ZHG4-1]

    Polymorphism databases

    DMDMi298286926.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ009660 mRNA. Translation: AAY26234.1 . Different initiation.
    AL355492 , AL590551 Genomic DNA. Translation: CAX14958.1 . Sequence problems.
    AL355492 , AL356417 , AL590551 Genomic DNA. Translation: CAX14959.1 .
    AL356417 , AL355492 , AL590551 Genomic DNA. Translation: CAX14843.1 .
    AB058769 mRNA. Translation: BAB47495.2 .
    BC146783 mRNA. Translation: AAI46784.1 . Different initiation.
    BC150607 mRNA. Translation: AAI50608.1 . Different initiation.
    AL832410 mRNA. Translation: CAI46178.2 .
    AJ586132 mRNA. Translation: CAE51894.1 . Frameshift.
    CCDSi CCDS47512.1. [Q4ZHG4-1 ]
    RefSeqi NP_115921.2. NM_032532.2. [Q4ZHG4-1 ]
    UniGenei Hs.520525.

    3D structure databases

    ProteinModelPortali Q4ZHG4.
    SMRi Q4ZHG4. Positions 40-123, 160-245, 263-455, 1652-1749.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000297267.

    PTM databases

    PhosphoSitei Q4ZHG4.

    Polymorphism databases

    DMDMi 298286926.

    Proteomic databases

    PaxDbi Q4ZHG4.
    PeptideAtlasi Q4ZHG4.
    PRIDEi Q4ZHG4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000297267 ; ENSP00000297267 ; ENSG00000164694 . [Q4ZHG4-1 ]
    GeneIDi 84624.
    KEGGi hsa:84624.
    UCSCi uc010kjv.3. human. [Q4ZHG4-1 ]

    Organism-specific databases

    CTDi 84624.
    GeneCardsi GC06P159590.
    H-InvDB HIX0006338.
    HGNCi HGNC:21184. FNDC1.
    HPAi HPA030962.
    HPA030963.
    MIMi 609991. gene.
    neXtProti NX_Q4ZHG4.
    PharmGKBi PA134906656.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG326991.
    HOVERGENi HBG107924.
    InParanoidi Q4ZHG4.
    OMAi NLNVWPV.
    OrthoDBi EOG7MH0XD.
    PhylomeDBi Q4ZHG4.
    TreeFami TF337588.

    Miscellaneous databases

    GenomeRNAii 84624.
    NextBioi 74520.
    PROi Q4ZHG4.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q4ZHG4.
    CleanExi HS_FNDC1.
    Genevestigatori Q4ZHG4.

    Family and domain databases

    Gene3Di 2.60.40.10. 5 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR013783. Ig-like_fold.
    [Graphical view ]
    Pfami PF00041. fn3. 4 hits.
    [Graphical view ]
    SMARTi SM00060. FN3. 5 hits.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 3 hits.
    PROSITEi PS50853. FN3. 5 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Use of differential subtraction method to identify genes that characterize the phenotype of cultured rheumatoid arthritis synoviocytes."
      Seki T., Selby J., Haupl T., Winchester R.
      Arthritis Rheum. 41:1356-1364(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS 1479-THR--THR-1484 DEL AND LYS-1504.
    2. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
      DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 43-1894 (ISOFORM 2), VARIANTS GLN-463; GLU-1003; GLU-1180; PRO-1261; ARG-1280; 1479-THR--THR-1484 DEL AND LYS-1504.
      Tissue: Brain.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 43-1894 (ISOFORMS 1 AND 2), VARIANTS ALA-438; GLN-463; GLU-1003; GLU-1180; PRO-1261; ARG-1280; 1479-THR--THR-1484 DEL AND LYS-1504.
      Tissue: Testis.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1196-1894 (ISOFORM 1), VARIANTS PRO-1261; ARG-1280; 1479-THR--THR-1484 DEL AND LYS-1504.
      Tissue: Lymph node.
    6. "MEL4B3, a novel mRNA is induced in skin tumors and regulated by TGF-beta and pro-inflammatory cytokines."
      Anderegg U., Breitschwerdt K., Koehler M.J., Sticherling M., Haustein U.-F., Simon J.C., Saalbach A.
      Exp. Dermatol. 14:709-718(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1295-1894 (ISOFORM 1), INDUCTION BY TGFB1, VARIANTS 1479-THR--THR-1484 DEL AND LYS-1504.

    Entry informationi

    Entry nameiFNDC1_HUMAN
    AccessioniPrimary (citable) accession number: Q4ZHG4
    Secondary accession number(s): A6H8X2
    , B7ZBR4, B7ZBR5, B9EK49, Q5JPI0, Q5VU31, Q5VU32, Q5VXX4, Q70CQ6, Q96JG1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 17, 2007
    Last sequence update: June 15, 2010
    Last modified: October 1, 2014
    This is version 87 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3