Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FLYWCH-type zinc finger-containing protein 1

Gene

FLYWCH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri116 – 17459FLYWCH-type 1Add
BLAST
Zinc fingeri273 – 33159FLYWCH-type 2Add
BLAST
Zinc fingeri421 – 47959FLYWCH-type 3Add
BLAST
Zinc fingeri509 – 56759FLYWCH-type 4Add
BLAST
Zinc fingeri600 – 65859FLYWCH-type 5Add
BLAST

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
FLYWCH-type zinc finger-containing protein 1
Gene namesi
Name:FLYWCH1
Synonyms:KIAA1552
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:25404. FLYWCH1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671760.

Polymorphism and mutation databases

BioMutaiFLYWCH1.
DMDMi166217021.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 716716FLYWCH-type zinc finger-containing protein 1PRO_0000314460Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei21 – 211PhosphoserineCombined sources
Modified residuei261 – 2611PhosphoserineCombined sources
Cross-linki393 – 393Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei503 – 5031PhosphoserineCombined sources
Modified residuei591 – 5911PhosphoserineCombined sources
Modified residuei696 – 6961PhosphoserineCombined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ4VC44.
MaxQBiQ4VC44.
PaxDbiQ4VC44.
PRIDEiQ4VC44.

PTM databases

iPTMnetiQ4VC44.
PhosphoSiteiQ4VC44.

Expressioni

Gene expression databases

BgeeiQ4VC44.
CleanExiHS_FLYWCH1.
ExpressionAtlasiQ4VC44. baseline and differential.
GenevisibleiQ4VC44. HS.

Organism-specific databases

HPAiHPA040753.
HPA041001.

Interactioni

Protein-protein interaction databases

BioGridi123983. 11 interactions.
IntActiQ4VC44. 11 interactions.
MINTiMINT-4937620.
STRINGi9606.ENSP00000399938.

Structurei

Secondary structure

1
716
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi599 – 6035Combined sources
Turni604 – 6063Combined sources
Beta strandi607 – 6126Combined sources
Beta strandi615 – 6228Combined sources
Beta strandi627 – 6315Combined sources
Helixi632 – 6343Combined sources
Beta strandi642 – 6465Combined sources
Beta strandi649 – 6524Combined sources
Helixi662 – 6709Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2RPRNMR-A595-674[»]
ProteinModelPortaliQ4VC44.
SMRiQ4VC44. Positions 112-190, 269-346, 420-494, 508-583, 595-674.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ4VC44.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi242 – 2454Poly-Glu

Sequence similaritiesi

Contains 5 FLYWCH-type zinc fingers.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri116 – 17459FLYWCH-type 1Add
BLAST
Zinc fingeri273 – 33159FLYWCH-type 2Add
BLAST
Zinc fingeri421 – 47959FLYWCH-type 3Add
BLAST
Zinc fingeri509 – 56759FLYWCH-type 4Add
BLAST
Zinc fingeri600 – 65859FLYWCH-type 5Add
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410J2VB. Eukaryota.
ENOG410YYIU. LUCA.
GeneTreeiENSGT00530000064166.
HOVERGENiHBG098123.
InParanoidiQ4VC44.
OMAiSPGGPEF.
OrthoDBiEOG7JT6VK.
PhylomeDBiQ4VC44.
TreeFamiTF337169.

Family and domain databases

InterProiIPR029279. FLYWCH_N.
IPR007588. Znf_FLYWCH.
[Graphical view]
PfamiPF04500. FLYWCH. 5 hits.
PF15423. FLYWCH_N. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q4VC44-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLPEPSEQE GESVKAGQEP SPKPGTDVIP AAPRKPREFS KLVLLTASDQ
60 70 80 90 100
DEDGVGSKPQ EVHCVLSLEM AGPATLASTL QILPVEEQGG VVQPALEMPE
110 120 130 140 150
QKCSKLDAAA PQSLEFLRTP FGGRLLVLES FLYKQEKAVG DKVYWKCRQH
160 170 180 190 200
AELGCRGRAI TRGLRATVMR GHCHAPDEQG LEARRQREKL PSLALPEGLG
210 220 230 240 250
EPQGPEGPGG RVEEPLEGVG PWQCPEEPEP TPGLVLSKPA LEEEEAPRAL
260 270 280 290 300
SLLSLPPKKR SILGLGQARP LEFLRTCYGG SFLVHESFLY KREKAVGDKV
310 320 330 340 350
YWTCRDHALH GCRSRAITQG QRVTVMRGHC HQPDMEGLEA RRQQEKAVET
360 370 380 390 400
LQAGQDGPGS QVDTLLRGVD SLLYRRGPGP LTLTRPRPRK RAKVEDQELP
410 420 430 440 450
TQPEAPDEHQ DMDADPGGPE FLKTPLGGSF LVYESFLYRR EKAAGEKVYW
460 470 480 490 500
TCRDQARMGC RSRAITQGRR VTVMRGHCHP PDLGGLEALR QREKRPNTAQ
510 520 530 540 550
RGSPGGPEFL KTPLGGSFLV YESFLYRREK AAGEKVYWTC RDQARMGCRS
560 570 580 590 600
RAITQGRRVM VMRRHCHPPD LGGLEALRQR EHFPNLAQWD SPDPLRPLEF
610 620 630 640 650
LRTSLGGRFL VHESFLYRKE KAAGEKVYWM CRDQARLGCR SRAITQGHRI
660 670 680 690 700
MVMRSHCHQP DLAGLEALRQ RERLPTTAQQ EDPEKIQVQL CFKTCSPESQ
710
QIYGDIKDVR LDGESQ
Length:716
Mass (Da):80,108
Last modified:January 15, 2008 - v2
Checksum:iBC1DD372CA925A72
GO
Isoform 2 (identifier: Q4VC44-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     108-108: Missing.

Show »
Length:715
Mass (Da):80,037
Checksum:iFF6024A5B29CADBA
GO
Isoform 3 (identifier: Q4VC44-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     504-504: P → PGAGLSFQWLFRILQLLGHAPVLLCPSGSSCLPSLPAPHGPCPALSIPLE

Show »
Length:765
Mass (Da):85,153
Checksum:iDF6068B9CB520511
GO
Isoform 4 (identifier: Q4VC44-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-325: Missing.

Show »
Length:391
Mass (Da):44,665
Checksum:iBC4C192159B5CD98
GO
Isoform 5 (identifier: Q4VC44-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-388: Missing.
     389-504: RKRAKVEDQE...RPNTAQRGSP → MPQATSPPLW...ADTASLKAWQ

Show »
Length:328
Mass (Da):36,821
Checksum:i96BE5A7C2B247109
GO

Sequence cautioni

The sequence BAB13378.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti666 – 6661E → G in AAH28572 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 388388Missing in isoform 5. 1 PublicationVSP_030277Add
BLAST
Alternative sequencei1 – 325325Missing in isoform 4. 1 PublicationVSP_030278Add
BLAST
Alternative sequencei108 – 1081Missing in isoform 2. 1 PublicationVSP_030279
Alternative sequencei389 – 504116RKRAK…QRGSP → MPQATSPPLWPLSLHGGKGI LWARHSHPPGPPSHHIQDSG RCSLPLPQSPGVTPLPARLS GATPLSPIRLLSSFVPRGPR VIPLTNQARRTLHASLGGCW GRTSDAADTASLKAWQ in isoform 5. 1 PublicationVSP_030280Add
BLAST
Alternative sequencei504 – 5041P → PGAGLSFQWLFRILQLLGHA PVLLCPSGSSCLPSLPAPHG PCPALSIPLE in isoform 3. 1 PublicationVSP_030281

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046772 mRNA. Translation: BAB13378.1. Different initiation.
AK127235 mRNA. Translation: BAC86896.1.
CH471112 Genomic DNA. Translation: EAW85450.1.
CH471112 Genomic DNA. Translation: EAW85451.1.
BC001973 mRNA. Translation: AAH01973.1.
BC018712 mRNA. Translation: AAH18712.1.
BC028572 mRNA. Translation: AAH28572.1.
AL136585 mRNA. Translation: CAB66520.2.
CCDSiCCDS45390.1. [Q4VC44-2]
CCDS76809.1. [Q4VC44-1]
RefSeqiNP_001294997.1. NM_001308068.1. [Q4VC44-1]
NP_065963.1. NM_020912.1.
NP_115672.2. NM_032296.2. [Q4VC44-2]
XP_006721025.1. XM_006720962.2. [Q4VC44-3]
UniGeneiHs.655321.

Genome annotation databases

EnsembliENST00000253928; ENSP00000253928; ENSG00000059122. [Q4VC44-1]
ENST00000416288; ENSP00000399938; ENSG00000059122. [Q4VC44-2]
GeneIDi84256.
KEGGihsa:84256.
UCSCiuc002csc.4. human. [Q4VC44-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046772 mRNA. Translation: BAB13378.1. Different initiation.
AK127235 mRNA. Translation: BAC86896.1.
CH471112 Genomic DNA. Translation: EAW85450.1.
CH471112 Genomic DNA. Translation: EAW85451.1.
BC001973 mRNA. Translation: AAH01973.1.
BC018712 mRNA. Translation: AAH18712.1.
BC028572 mRNA. Translation: AAH28572.1.
AL136585 mRNA. Translation: CAB66520.2.
CCDSiCCDS45390.1. [Q4VC44-2]
CCDS76809.1. [Q4VC44-1]
RefSeqiNP_001294997.1. NM_001308068.1. [Q4VC44-1]
NP_065963.1. NM_020912.1.
NP_115672.2. NM_032296.2. [Q4VC44-2]
XP_006721025.1. XM_006720962.2. [Q4VC44-3]
UniGeneiHs.655321.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2RPRNMR-A595-674[»]
ProteinModelPortaliQ4VC44.
SMRiQ4VC44. Positions 112-190, 269-346, 420-494, 508-583, 595-674.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123983. 11 interactions.
IntActiQ4VC44. 11 interactions.
MINTiMINT-4937620.
STRINGi9606.ENSP00000399938.

PTM databases

iPTMnetiQ4VC44.
PhosphoSiteiQ4VC44.

Polymorphism and mutation databases

BioMutaiFLYWCH1.
DMDMi166217021.

Proteomic databases

EPDiQ4VC44.
MaxQBiQ4VC44.
PaxDbiQ4VC44.
PRIDEiQ4VC44.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000253928; ENSP00000253928; ENSG00000059122. [Q4VC44-1]
ENST00000416288; ENSP00000399938; ENSG00000059122. [Q4VC44-2]
GeneIDi84256.
KEGGihsa:84256.
UCSCiuc002csc.4. human. [Q4VC44-1]

Organism-specific databases

CTDi84256.
GeneCardsiFLYWCH1.
H-InvDBHIX0202242.
HGNCiHGNC:25404. FLYWCH1.
HPAiHPA040753.
HPA041001.
neXtProtiNX_Q4VC44.
PharmGKBiPA142671760.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J2VB. Eukaryota.
ENOG410YYIU. LUCA.
GeneTreeiENSGT00530000064166.
HOVERGENiHBG098123.
InParanoidiQ4VC44.
OMAiSPGGPEF.
OrthoDBiEOG7JT6VK.
PhylomeDBiQ4VC44.
TreeFamiTF337169.

Miscellaneous databases

EvolutionaryTraceiQ4VC44.
GenomeRNAii84256.
PROiQ4VC44.

Gene expression databases

BgeeiQ4VC44.
CleanExiHS_FLYWCH1.
ExpressionAtlasiQ4VC44. baseline and differential.
GenevisibleiQ4VC44. HS.

Family and domain databases

InterProiIPR029279. FLYWCH_N.
IPR007588. Znf_FLYWCH.
[Graphical view]
PfamiPF04500. FLYWCH. 5 hits.
PF15423. FLYWCH_N. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O.
    DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Hippocampus.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
    Tissue: Eye, Placenta and Testis.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 273-716 (ISOFORM 3).
    Tissue: Amygdala.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21 AND SER-696, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-21; SER-261; SER-503 AND SER-591, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Uncovering global SUMOylation signaling networks in a site-specific manner."
    Hendriks I.A., D'Souza R.C., Yang B., Verlaan-de Vries M., Mann M., Vertegaal A.C.
    Nat. Struct. Mol. Biol. 21:927-936(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-393, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "Solution structure of the fifth FLYWCH domain of FLYWCH-type zinc finger-containing protein 1."
    RIKEN structural genomics initiative (RSGI)
    Submitted (AUG-2009) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 595-674.

Entry informationi

Entry nameiFWCH1_HUMAN
AccessioniPrimary (citable) accession number: Q4VC44
Secondary accession number(s): D3DUA1
, Q6ZSQ1, Q8WV62, Q9BQG6, Q9BUS5, Q9HCM0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: June 8, 2016
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.