Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

FLYWCH-type zinc finger-containing protein 1

Gene

FLYWCH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri116 – 174FLYWCH-type 1Add BLAST59
Zinc fingeri273 – 331FLYWCH-type 2Add BLAST59
Zinc fingeri421 – 479FLYWCH-type 3Add BLAST59
Zinc fingeri509 – 567FLYWCH-type 4Add BLAST59
Zinc fingeri600 – 658FLYWCH-type 5Add BLAST59

GO - Molecular functioni

Keywordsi

Molecular functionDNA-binding
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
FLYWCH-type zinc finger-containing protein 1
Gene namesi
Name:FLYWCH1
Synonyms:KIAA1552
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000059122.16
HGNCiHGNC:25404 FLYWCH1
neXtProtiNX_Q4VC44

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi84256
OpenTargetsiENSG00000059122
PharmGKBiPA142671760

Polymorphism and mutation databases

BioMutaiFLYWCH1
DMDMi166217021

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003144601 – 716FLYWCH-type zinc finger-containing protein 1Add BLAST716

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei21PhosphoserineCombined sources1
Cross-linki134Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei261PhosphoserineCombined sources1
Modified residuei371PhosphoserineCombined sources1
Cross-linki393Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei503PhosphoserineCombined sources1
Modified residuei591PhosphoserineCombined sources1
Cross-linki685Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei696PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ4VC44
PaxDbiQ4VC44
PeptideAtlasiQ4VC44
PRIDEiQ4VC44
ProteomicsDBi62302
62303 [Q4VC44-2]
62304 [Q4VC44-3]
62305 [Q4VC44-4]
62306 [Q4VC44-5]

PTM databases

iPTMnetiQ4VC44
PhosphoSitePlusiQ4VC44

Expressioni

Gene expression databases

BgeeiENSG00000059122
CleanExiHS_FLYWCH1
ExpressionAtlasiQ4VC44 baseline and differential
GenevisibleiQ4VC44 HS

Organism-specific databases

HPAiHPA040753
HPA041001

Interactioni

Protein-protein interaction databases

BioGridi123983, 12 interactors
IntActiQ4VC44, 21 interactors
MINTiQ4VC44

Structurei

Secondary structure

1716
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi599 – 603Combined sources5
Turni604 – 606Combined sources3
Beta strandi607 – 612Combined sources6
Beta strandi615 – 622Combined sources8
Beta strandi627 – 631Combined sources5
Helixi632 – 634Combined sources3
Beta strandi642 – 646Combined sources5
Beta strandi649 – 652Combined sources4
Helixi662 – 670Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2RPRNMR-A595-674[»]
ProteinModelPortaliQ4VC44
SMRiQ4VC44
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ4VC44

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi242 – 245Poly-Glu4

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri116 – 174FLYWCH-type 1Add BLAST59
Zinc fingeri273 – 331FLYWCH-type 2Add BLAST59
Zinc fingeri421 – 479FLYWCH-type 3Add BLAST59
Zinc fingeri509 – 567FLYWCH-type 4Add BLAST59
Zinc fingeri600 – 658FLYWCH-type 5Add BLAST59

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410J2VB Eukaryota
ENOG410YYIU LUCA
GeneTreeiENSGT00530000064166
HOVERGENiHBG098123
InParanoidiQ4VC44
OMAiDKVYWTC
OrthoDBiEOG091G0PRI
PhylomeDBiQ4VC44
TreeFamiTF337169

Family and domain databases

InterProiView protein in InterPro
IPR029279 FLYWCH_N
IPR007588 Znf_FLYWCH
PfamiView protein in Pfam
PF04500 FLYWCH, 5 hits
PF15423 FLYWCH_N, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q4VC44-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLPEPSEQE GESVKAGQEP SPKPGTDVIP AAPRKPREFS KLVLLTASDQ
60 70 80 90 100
DEDGVGSKPQ EVHCVLSLEM AGPATLASTL QILPVEEQGG VVQPALEMPE
110 120 130 140 150
QKCSKLDAAA PQSLEFLRTP FGGRLLVLES FLYKQEKAVG DKVYWKCRQH
160 170 180 190 200
AELGCRGRAI TRGLRATVMR GHCHAPDEQG LEARRQREKL PSLALPEGLG
210 220 230 240 250
EPQGPEGPGG RVEEPLEGVG PWQCPEEPEP TPGLVLSKPA LEEEEAPRAL
260 270 280 290 300
SLLSLPPKKR SILGLGQARP LEFLRTCYGG SFLVHESFLY KREKAVGDKV
310 320 330 340 350
YWTCRDHALH GCRSRAITQG QRVTVMRGHC HQPDMEGLEA RRQQEKAVET
360 370 380 390 400
LQAGQDGPGS QVDTLLRGVD SLLYRRGPGP LTLTRPRPRK RAKVEDQELP
410 420 430 440 450
TQPEAPDEHQ DMDADPGGPE FLKTPLGGSF LVYESFLYRR EKAAGEKVYW
460 470 480 490 500
TCRDQARMGC RSRAITQGRR VTVMRGHCHP PDLGGLEALR QREKRPNTAQ
510 520 530 540 550
RGSPGGPEFL KTPLGGSFLV YESFLYRREK AAGEKVYWTC RDQARMGCRS
560 570 580 590 600
RAITQGRRVM VMRRHCHPPD LGGLEALRQR EHFPNLAQWD SPDPLRPLEF
610 620 630 640 650
LRTSLGGRFL VHESFLYRKE KAAGEKVYWM CRDQARLGCR SRAITQGHRI
660 670 680 690 700
MVMRSHCHQP DLAGLEALRQ RERLPTTAQQ EDPEKIQVQL CFKTCSPESQ
710
QIYGDIKDVR LDGESQ
Length:716
Mass (Da):80,108
Last modified:January 15, 2008 - v2
Checksum:iBC1DD372CA925A72
GO
Isoform 2 (identifier: Q4VC44-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     108-108: Missing.

Show »
Length:715
Mass (Da):80,037
Checksum:iFF6024A5B29CADBA
GO
Isoform 3 (identifier: Q4VC44-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     504-504: P → PGAGLSFQWLFRILQLLGHAPVLLCPSGSSCLPSLPAPHGPCPALSIPLE

Show »
Length:765
Mass (Da):85,153
Checksum:iDF6068B9CB520511
GO
Isoform 4 (identifier: Q4VC44-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-325: Missing.

Show »
Length:391
Mass (Da):44,665
Checksum:iBC4C192159B5CD98
GO
Isoform 5 (identifier: Q4VC44-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-388: Missing.
     389-504: RKRAKVEDQE...RPNTAQRGSP → MPQATSPPLW...ADTASLKAWQ

Show »
Length:328
Mass (Da):36,821
Checksum:i96BE5A7C2B247109
GO

Sequence cautioni

The sequence BAB13378 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti666E → G in AAH28572 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0302771 – 388Missing in isoform 5. 1 PublicationAdd BLAST388
Alternative sequenceiVSP_0302781 – 325Missing in isoform 4. 1 PublicationAdd BLAST325
Alternative sequenceiVSP_030279108Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_030280389 – 504RKRAK…QRGSP → MPQATSPPLWPLSLHGGKGI LWARHSHPPGPPSHHIQDSG RCSLPLPQSPGVTPLPARLS GATPLSPIRLLSSFVPRGPR VIPLTNQARRTLHASLGGCW GRTSDAADTASLKAWQ in isoform 5. 1 PublicationAdd BLAST116
Alternative sequenceiVSP_030281504P → PGAGLSFQWLFRILQLLGHA PVLLCPSGSSCLPSLPAPHG PCPALSIPLE in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046772 mRNA Translation: BAB13378.1 Different initiation.
AK127235 mRNA Translation: BAC86896.1
CH471112 Genomic DNA Translation: EAW85450.1
CH471112 Genomic DNA Translation: EAW85451.1
BC001973 mRNA Translation: AAH01973.1
BC018712 mRNA Translation: AAH18712.1
BC028572 mRNA Translation: AAH28572.1
AL136585 mRNA Translation: CAB66520.2
CCDSiCCDS45390.1 [Q4VC44-2]
CCDS76809.1 [Q4VC44-1]
RefSeqiNP_001294997.1, NM_001308068.1 [Q4VC44-1]
NP_065963.1, NM_020912.1
NP_115672.2, NM_032296.2 [Q4VC44-2]
XP_006721025.1, XM_006720962.3 [Q4VC44-3]
UniGeneiHs.655321

Genome annotation databases

EnsembliENST00000253928; ENSP00000253928; ENSG00000059122 [Q4VC44-1]
ENST00000416288; ENSP00000399938; ENSG00000059122 [Q4VC44-2]
GeneIDi84256
KEGGihsa:84256
UCSCiuc002csc.4 human [Q4VC44-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFWCH1_HUMAN
AccessioniPrimary (citable) accession number: Q4VC44
Secondary accession number(s): D3DUA1
, Q6ZSQ1, Q8WV62, Q9BQG6, Q9BUS5, Q9HCM0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: June 20, 2018
This is version 101 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health