Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Macrophage erythroblast attacher

Gene

Maea

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in erythroblast enucleation and in the development of the mature macrophages. Mediates the attachment of erythroid cell to mature macrophages, in correlation with the presence of MAEA at cell surface of mature macrophages; This MAEA-mediated contact inhibits erythroid cells apoptosis. Participates in erythroblastic island formation, which is the functional unit of definitive erythropoiesis. Associates with F-actin to regulate actin distribution in erythroblasts and macrophages. May contribute to nuclear architecture and cells division events.2 Publications

GO - Molecular functioni

  • actin binding Source: MGI

GO - Biological processi

  • cell adhesion Source: MGI
  • cell cycle Source: UniProtKB-KW
  • cell division Source: UniProtKB-KW
  • cytoskeleton organization Source: MGI
  • enucleate erythrocyte development Source: MGI
  • erythrocyte development Source: MGI
  • erythrocyte maturation Source: UniProtKB-KW
  • negative regulation of apoptotic process Source: GO_Central
  • negative regulation of gluconeogenesis Source: InterPro
  • negative regulation of myeloid cell apoptotic process Source: MGI
  • proteasome-mediated ubiquitin-dependent protein catabolic process Source: GO_Central
  • protein ubiquitination Source: GOC

Keywordsi

Molecular functionActin-binding
Biological processCell cycle, Cell division, Erythrocyte maturation

Names & Taxonomyi

Protein namesi
Recommended name:
Macrophage erythroblast attacher
Alternative name(s):
Erythroblast macrophage protein
Gene namesi
Name:Maea
Synonyms:Emp
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1891748 Maea

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Nucleus

Pathology & Biotechi

Disruption phenotypei

Mice die perinatally and exhibit profound alterations in the hematopoietic system. Blood of E14.5-16.5 embryos contained mostly nucleated erythrocytes suggesting a defect in terminal maturation and enucleation of precursor cells. In the fetal liver, large immature erythroblasts predominate, macrophage exhibit an immature morphology and their number is reduced; No erythroblasts are attached to the macrophages suggesting impairment of erythroblastic island formation.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002849381 – 396Macrophage erythroblast attacherAdd BLAST396

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei28PhosphothreonineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ4VC33
PaxDbiQ4VC33
PeptideAtlasiQ4VC33
PRIDEiQ4VC33

PTM databases

iPTMnetiQ4VC33
PhosphoSitePlusiQ4VC33

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSMUSG00000079562
CleanExiMM_MAEA
ExpressionAtlasiQ4VC33 baseline and differential
GenevisibleiQ4VC33 MM

Interactioni

Subunit structurei

Forms a complex with F-actin.1 Publication

GO - Molecular functioni

  • actin binding Source: MGI

Protein-protein interaction databases

IntActiQ4VC33, 1 interactor
STRINGi10090.ENSMUSP00000110093

Structurei

3D structure databases

ProteinModelPortaliQ4VC33
SMRiQ4VC33
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini121 – 153LisHPROSITE-ProRule annotationAdd BLAST33
Domaini159 – 216CTLHPROSITE-ProRule annotationAdd BLAST58

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 124Extracellular and involved in cell to cell contactBy similarityAdd BLAST124

Phylogenomic databases

eggNOGiKOG0396 Eukaryota
ENOG410XPGU LUCA
GeneTreeiENSGT00720000108841
HOVERGENiHBG053270
InParanoidiQ4VC33
KOiK18624
OMAiYAHHTKS
OrthoDBiEOG091G0E8J
PhylomeDBiQ4VC33
TreeFamiTF314273

Family and domain databases

InterProiView protein in InterPro
IPR013144 CRA_dom
IPR024964 CTLH/CRA
IPR006595 CTLH_C
IPR027714 Fyv10/EMP
IPR006594 LisH
PANTHERiPTHR12170:SF2 PTHR12170:SF2, 1 hit
PfamiView protein in Pfam
PF10607 CLTH, 1 hit
SMARTiView protein in SMART
SM00757 CRA, 1 hit
SM00668 CTLH, 1 hit
SM00667 LisH, 1 hit
PROSITEiView protein in PROSITE
PS50897 CTLH, 1 hit
PS50896 LISH, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q4VC33-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVQESAAQL SMTLKVQEYP TLKVPYETLN KRFRAAQKNI DRETSHVTMV
60 70 80 90 100
VAELEKTLSS CPAVDSVVSL LDGVVEKLSV LKRKAVESIQ AEDESAKLCK
110 120 130 140 150
RRIEHLKEHS SDQPAAASMW KRKRMDRMMV EHLLRCGYYN TAVKLARQSG
160 170 180 190 200
IEDLVNIEMF LTAKEVEESL ERRETATCLA WCHDNKSRLR KMKSCLEFSL
210 220 230 240 250
RIQEFIELVR QNKRLDAVRH ARKHFSQAEG SQLDEVRQVM GMLAFPPDTH
260 270 280 290 300
ISPYKDLLDP ARWRMLIQQF RYDNYRLHQL GNSSVFTLTL QAGLSAIKTP
310 320 330 340 350
QCYKEDGSSK SPDCPVCSRS LNKLAQPLPM AHCANSRLVC KISGDVMNEN
360 370 380 390
NPPMMLPNGY VYGYNSLLSI RQDDKVVCPR TKEVFHFSQA EKVYIM
Length:396
Mass (Da):45,336
Last modified:July 5, 2005 - v1
Checksum:i686F1E086742B99B
GO
Isoform 2 (identifier: Q4VC33-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-396: M → MYAPSCYGHALGQSGGGWEPCPPALTPDPRPQPASTFVSCDQRSVSNDKYS

Show »
Length:446
Mass (Da):50,602
Checksum:i3D84FB9200D658ED
GO

Sequence cautioni

The sequence BAC35873 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti148Q → R in BAE31283 (PubMed:16141072).Curated1
Sequence conflicti203Q → R in BAC28857 (PubMed:16141072).Curated1
Sequence conflicti206I → V in BAE40928 (PubMed:16141072).Curated1
Sequence conflicti326Q → R in BAE31283 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024797396M → MYAPSCYGHALGQSGGGWEP CPPALTPDPRPQPASTFVSC DQRSVSNDKYS in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK034859 mRNA Translation: BAC28857.1
AK075637 mRNA Translation: BAC35873.1 Different initiation.
AK145800 mRNA Translation: BAE26657.1
AK152523 mRNA Translation: BAE31283.1
AK169149 mRNA Translation: BAE40928.1
BC039054 mRNA Translation: AAH39054.1
BC058687 mRNA Translation: AAH58687.1
AF263247 mRNA Translation: AAF72195.1
CCDSiCCDS39063.1 [Q4VC33-1]
RefSeqiNP_067475.2, NM_021500.2 [Q4VC33-1]
UniGeneiMm.138617
Mm.281642

Genome annotation databases

EnsembliENSMUST00000114449; ENSMUSP00000110093; ENSMUSG00000079562 [Q4VC33-1]
GeneIDi59003
KEGGimmu:59003
UCSCiuc008xap.1 mouse [Q4VC33-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMAEA_MOUSE
AccessioniPrimary (citable) accession number: Q4VC33
Secondary accession number(s): Q3TFH0
, Q3U7T6, Q5XKE6, Q8BPI3, Q8BSA1, Q9JK49
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: July 5, 2005
Last modified: April 25, 2018
This is version 109 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health