Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pleckstrin homology domain-containing family G member 3

Gene

Plekhg3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Pleckstrin homology domain-containing family G member 3
Short name:
PH domain-containing family G member 3
Gene namesi
Name:Plekhg3
Synonyms:Kiaa0599
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 12

Organism-specific databases

MGIiMGI:2388284. Plekhg3.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13411341Pleckstrin homology domain-containing family G member 3PRO_0000306864Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei76 – 761PhosphoserineBy similarity
Modified residuei433 – 4331PhosphoserineCombined sources
Modified residuei502 – 5021PhosphoserineCombined sources
Modified residuei571 – 5711PhosphoserineCombined sources
Modified residuei694 – 6941PhosphoserineBy similarity
Modified residuei695 – 6951PhosphoserineBy similarity
Modified residuei737 – 7371PhosphoserineCombined sources
Modified residuei759 – 7591PhosphoserineBy similarity
Modified residuei762 – 7621PhosphoserineCombined sources
Modified residuei766 – 7661PhosphoserineCombined sources
Modified residuei862 – 8621PhosphoserineBy similarity
Modified residuei899 – 8991PhosphoserineCombined sources
Modified residuei900 – 9001PhosphoserineCombined sources
Modified residuei947 – 9471PhosphoserineBy similarity
Modified residuei1129 – 11291PhosphoserineBy similarity
Modified residuei1134 – 11341PhosphoserineCombined sources
Modified residuei1136 – 11361PhosphoserineCombined sources
Modified residuei1141 – 11411PhosphoserineCombined sources
Modified residuei1155 – 11551PhosphoserineCombined sources
Modified residuei1158 – 11581PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ4VAC9.
PaxDbiQ4VAC9.
PRIDEiQ4VAC9.

PTM databases

iPTMnetiQ4VAC9.
PhosphoSiteiQ4VAC9.

Expressioni

Gene expression databases

BgeeiQ4VAC9.
GenevisibleiQ4VAC9. MM.

Interactioni

Protein-protein interaction databases

BioGridi234453. 1 interaction.
DIPiDIP-49616N.
IntActiQ4VAC9. 1 interaction.
STRINGi10090.ENSMUSP00000074729.

Structurei

3D structure databases

ProteinModelPortaliQ4VAC9.
SMRiQ4VAC9. Positions 97-441.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini93 – 272180DHPROSITE-ProRule annotationAdd
BLAST
Domaini296 – 39499PHPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi521 – 710190Glu-richAdd
BLAST

Sequence similaritiesi

Contains 1 DH (DBL-homology) domain.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3518. Eukaryota.
ENOG410XR81. LUCA.
GeneTreeiENSGT00760000118925.
HOVERGENiHBG071520.
InParanoidiQ4VAC9.
OMAiNMVEPPL.
OrthoDBiEOG7K9K2H.
TreeFamiTF328565.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q4VAC9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVSTALHQD GSQERPRSLV STTSSSGSSR DSHSAMEEPT GSEASAQNGT
60 70 80 90 100
GSPWDRHVPN SNNNSSGWLN MKGPLSPFNG RAGTSPAYHK LSYLGRVVRE
110 120 130 140 150
IVETERMYVQ DLRSIVEDYL LKIIDTPGLL KPEQVSALFG NIESIYALNS
160 170 180 190 200
QLLRDLDSCN SDPVAVASCF VERSQEFDIY TQYCNNYPNS VAALTECMQD
210 220 230 240 250
KQQAKFFRDR QELLQHSLPL GSYLLKPVQR VLKYHLLLQE IAKHFDEEED
260 270 280 290 300
GFEVVEDAID TMTCVAWYIN DMKRRHEHAV RLQEIQSLLI NWKGPDLTTY
310 320 330 340 350
GELVLEATFR VHRVRNDRTF FLFDKILLIT KKRGDHFVYK GHIPCSSLML
360 370 380 390 400
IESTRDSLCF TVTHYKHSKQ QYSIQAKTVE EKRSWTHHIK RLILENHHAT
410 420 430 440 450
IPQKAKEAIL EMDSYYPSRY RCSPERMKKA WSSQDEVSSH VRQGRRQSEP
460 470 480 490 500
GHTLFSRATL PSRQQGFEMP GLKGRRKSEP TRHLLRQLSE KARAVGMKHA
510 520 530 540 550
GSAGALLDFG QPAHAQKQQP EAERAAREEL EEEEELVEEE EQRQQSFSGS
560 570 580 590 600
LEGLAGHDGS EKVPGPELPG SEEEEEEEES LAVAEQGKRH RESEGSKGCR
610 620 630 640 650
RPSNRSPTSA EKRMSFESVS SLPEVETDPE PGAEQEAFAA LEGPSTEEMP
660 670 680 690 700
SDPEFPEALE TQLHAPKGLL GVDNPAAVVD FVEPEGSEDL KPLSSEEEEE
710 720 730 740 750
EEMEAAQEPE SLLPPSVLDQ ASVIAERFAS SFSRRSSLAI EDGKSSGLGT
760 770 780 790 800
PRLISRSSSV LSLEGSDKGL ARWSSIGDSL SNPPTPEVII GADMVTDNGP
810 820 830 840 850
SVNGTESPSA GSGCPTEQDR SSCKKKESAL STRDRQLLDK IKNYYENAEH
860 870 880 890 900
HDAGFSIRRR ESLSYIPKGL VRSSVSRFNS LPKPDSEPAA PVGYKRPGSS
910 920 930 940 950
RPASWTLFDL PGPRTDKGDP APITDAEFCP SSEIAKIWER MESSERSPRT
960 970 980 990 1000
GSGQSQANGF ELQEPLFILE EHELGAITEE SAVASPESAS PTEQPSPAHL
1010 1020 1030 1040 1050
ARELKELVKE LSSSVQGELV TPLHPRIVQL SHVMDSHVSE RVKNKVYQLA
1060 1070 1080 1090 1100
RQYSLRIKNI KAARPPLQWE KVTPDQEEQV PSISGLPEEA GELSGGKARR
1110 1120 1130 1140 1150
KPVLSLLSYE QLVAQEHGTS KSSAAVETSP RRFSFSPSAV SPRTTSPGAR
1160 1170 1180 1190 1200
SSARSPLSPF DTETFNWPDV RELCSKYTSH DKTAQVESSW PRSLLVNRSR
1210 1220 1230 1240 1250
SLPENIVEPP MSGKADRCCG LNTHRRLGDG EASQPPLPES PPQSQLNGGD
1260 1270 1280 1290 1300
ALYVTADLTL ENNQRVIIME KGPHPSSTVG LEEDSGKESS SPVALKGQGQ
1310 1320 1330 1340
GFQASAEYQP KEHGPRDSAD TNKQGRVRNL REKFQALNSV G
Length:1,341
Mass (Da):148,519
Last modified:July 27, 2011 - v2
Checksum:iFFB1EDA92BF6E197
GO
Isoform 2 (identifier: Q4VAC9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     451-480: Missing.
     586-586: Q → QVADFASSLLAALHCWHYRANALLFSRGAM

Note: No experimental confirmation available.
Show »
Length:1,340
Mass (Da):148,342
Checksum:i2FAEE18DEA48F442
GO
Isoform 3 (identifier: Q4VAC9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     449-627: EPGHTLFSRA...SVSSLPEVET → GEGRAVWTRT...LLREDKNLAL
     628-1341: Missing.

Note: No experimental confirmation available.
Show »
Length:627
Mass (Da):71,523
Checksum:i93FE3C46E7774424
GO
Isoform 4 (identifier: Q4VAC9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-197: Missing.
     416-431: YPSRYRCSPERMKKAW → CKLPFSACFIPNCVHG
     432-1341: Missing.

Note: No experimental confirmation available.
Show »
Length:234
Mass (Da):27,678
Checksum:i759B120F0E6270C1
GO
Isoform 5 (identifier: Q4VAC9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-613: Missing.

Note: No experimental confirmation available.
Show »
Length:728
Mass (Da):78,849
Checksum:i985EBCBF53887230
GO

Sequence cautioni

The sequence BAE36687.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti203 – 2031Q → K in BAE36687 (PubMed:16141072).Curated
Sequence conflicti216 – 2161H → Q in BAE36687 (PubMed:16141072).Curated
Sequence conflicti580 – 5856SLAVAE → ADFCLL in BAD32255 (PubMed:15368895).Curated
Sequence conflicti929 – 9291C → R in AAH96443 (PubMed:15489334).Curated
Sequence conflicti929 – 9291C → R in AAH31136 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 613613Missing in isoform 5. 1 PublicationVSP_028535Add
BLAST
Alternative sequencei1 – 197197Missing in isoform 4. 1 PublicationVSP_028536Add
BLAST
Alternative sequencei416 – 43116YPSRY…MKKAW → CKLPFSACFIPNCVHG in isoform 4. 1 PublicationVSP_028537Add
BLAST
Alternative sequencei432 – 1341910Missing in isoform 4. 1 PublicationVSP_028538Add
BLAST
Alternative sequencei449 – 627179EPGHT…PEVET → GEGRAVWTRTFFLGSLAQAG IICSDIVGRWSLQKAGEDSR VGWWMSVDRFLFMPGFPSNN HLLCLLLTRAVHLLKGLGMF VIQDLASLLSHLNLLALLLS QSSTWKSWDSFSVQVSSDSR GWVGGKTLRPSGTKSRQEIF ILGHAIFLSWVFFHDGICLC ARGVIRMKRLLREDKNLAL in isoform 3. 1 PublicationVSP_028539Add
BLAST
Alternative sequencei451 – 48030Missing in isoform 2. 1 PublicationVSP_028540Add
BLAST
Alternative sequencei586 – 5861Q → QVADFASSLLAALHCWHYRA NALLFSRGAM in isoform 2. 1 PublicationVSP_028541
Alternative sequencei628 – 1341714Missing in isoform 3. 1 PublicationVSP_028542Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK080928 mRNA. Translation: BAC38083.1.
AK162025 mRNA. Translation: BAE36687.1. Different initiation.
AC163033 Genomic DNA. No translation available.
BC030417 mRNA. Translation: AAH30417.1.
BC031136 mRNA. Translation: AAH31136.1.
BC049264 mRNA. Translation: AAH49264.1.
BC096443 mRNA. Translation: AAH96443.1.
AK172977 mRNA. Translation: BAD32255.1.
CCDSiCCDS25994.1. [Q4VAC9-1]
RefSeqiNP_722499.4. NM_153804.4. [Q4VAC9-1]
XP_006515938.1. XM_006515875.2. [Q4VAC9-2]
UniGeneiMm.291854.

Genome annotation databases

EnsembliENSMUST00000075249; ENSMUSP00000074729; ENSMUSG00000052609. [Q4VAC9-1]
GeneIDi263406.
KEGGimmu:263406.
UCSCiuc007nyi.2. mouse. [Q4VAC9-3]
uc007nyj.2. mouse. [Q4VAC9-2]
uc007nyk.2. mouse. [Q4VAC9-1]
uc029rtp.1. mouse. [Q4VAC9-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK080928 mRNA. Translation: BAC38083.1.
AK162025 mRNA. Translation: BAE36687.1. Different initiation.
AC163033 Genomic DNA. No translation available.
BC030417 mRNA. Translation: AAH30417.1.
BC031136 mRNA. Translation: AAH31136.1.
BC049264 mRNA. Translation: AAH49264.1.
BC096443 mRNA. Translation: AAH96443.1.
AK172977 mRNA. Translation: BAD32255.1.
CCDSiCCDS25994.1. [Q4VAC9-1]
RefSeqiNP_722499.4. NM_153804.4. [Q4VAC9-1]
XP_006515938.1. XM_006515875.2. [Q4VAC9-2]
UniGeneiMm.291854.

3D structure databases

ProteinModelPortaliQ4VAC9.
SMRiQ4VAC9. Positions 97-441.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi234453. 1 interaction.
DIPiDIP-49616N.
IntActiQ4VAC9. 1 interaction.
STRINGi10090.ENSMUSP00000074729.

PTM databases

iPTMnetiQ4VAC9.
PhosphoSiteiQ4VAC9.

Proteomic databases

MaxQBiQ4VAC9.
PaxDbiQ4VAC9.
PRIDEiQ4VAC9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000075249; ENSMUSP00000074729; ENSMUSG00000052609. [Q4VAC9-1]
GeneIDi263406.
KEGGimmu:263406.
UCSCiuc007nyi.2. mouse. [Q4VAC9-3]
uc007nyj.2. mouse. [Q4VAC9-2]
uc007nyk.2. mouse. [Q4VAC9-1]
uc029rtp.1. mouse. [Q4VAC9-4]

Organism-specific databases

CTDi26030.
MGIiMGI:2388284. Plekhg3.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG3518. Eukaryota.
ENOG410XR81. LUCA.
GeneTreeiENSGT00760000118925.
HOVERGENiHBG071520.
InParanoidiQ4VAC9.
OMAiNMVEPPL.
OrthoDBiEOG7K9K2H.
TreeFamiTF328565.

Miscellaneous databases

ChiTaRSiPlekhg3. mouse.
NextBioi392129.
PROiQ4VAC9.
SOURCEiSearch...

Gene expression databases

BgeeiQ4VAC9.
GenevisibleiQ4VAC9. MM.

Family and domain databases

Gene3Di1.20.900.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR000219. DH-domain.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00621. RhoGEF. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00325. RhoGEF. 1 hit.
[Graphical view]
SUPFAMiSSF48065. SSF48065. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS50010. DH_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-697 (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Adipose tissue and Muellerian duct.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 5).
    Strain: FVB/N.
    Tissue: Eye, Kidney and Salivary gland.
  4. "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H.
    DNA Res. 11:205-218(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 580-1341.
    Tissue: Brain.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-502 AND SER-571, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-433; SER-502; SER-571; SER-737; SER-762; SER-766; SER-899; SER-900; SER-1134; SER-1136; SER-1141; SER-1155 AND SER-1158, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Kidney, Liver, Spleen and Testis.

Entry informationi

Entry nameiPKHG3_MOUSE
AccessioniPrimary (citable) accession number: Q4VAC9
Secondary accession number(s): E9QL46
, Q3TSI8, Q6A041, Q8BJP5, Q8K0L5, Q8K0T6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: July 27, 2011
Last modified: January 20, 2016
This is version 89 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.