Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Xin actin-binding repeat-containing protein 2

Gene

Xirp2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Protects actin filaments from depolymerization.By similarity

GO - Molecular functioni

  • alpha-actinin binding Source: MGI
  • zinc ion binding Source: InterPro

GO - Biological processi

  • actin cytoskeleton organization Source: InterPro
  • cardiac muscle tissue morphogenesis Source: MGI
  • cell-cell junction organization Source: MGI
  • ventricular septum development Source: MGI
Complete GO annotation...

Keywords - Ligandi

Actin-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Xin actin-binding repeat-containing protein 2
Alternative name(s):
Beta-xin
Cardiomyopathy-associated protein 3
Myogenic MEF2-activated Xin-related protein
Myomaxin
mXinbeta
Gene namesi
Name:Xirp2
Synonyms:Cmya3, Xin2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:2685198. Xirp2.

Subcellular locationi

GO - Cellular componenti

  • cell junction Source: UniProtKB-SubCell
  • Z disc Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003169881 – 3784Xin actin-binding repeat-containing protein 2Add BLAST3784

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei123PhosphoserineCombined sources1
Modified residuei567PhosphoserineBy similarity1
Modified residuei635PhosphoserineBy similarity1
Modified residuei815PhosphoserineCombined sources1
Modified residuei1212PhosphoserineBy similarity1
Modified residuei1576PhosphoserineBy similarity1
Modified residuei2139PhosphoserineCombined sources1
Modified residuei2192PhosphoserineBy similarity1
Modified residuei2974PhosphoserineCombined sources1
Modified residuei3206PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ4U4S6.
PRIDEiQ4U4S6.

PTM databases

iPTMnetiQ4U4S6.
PhosphoSitePlusiQ4U4S6.

Expressioni

Tissue specificityi

Expression is restricted to heart and skeletal muscle. Present in intercalated disks of the heart and in the Z-disk region of skeletal muscle (at protein level).2 Publications

Inductioni

By MEF2A in skeletal muscle. By angiotensin II in heart.2 Publications

Gene expression databases

BgeeiENSMUSG00000027022.
CleanExiMM_XIRP2.

Interactioni

Subunit structurei

Interacts with ACTN2. Interacts with F-actin (By similarity).By similarity

GO - Molecular functioni

  • alpha-actinin binding Source: MGI

Protein-protein interaction databases

BioGridi232312. 1 interactor.
IntActiQ4U4S6. 1 interactor.
STRINGi10090.ENSMUSP00000028410.

Structurei

3D structure databases

ProteinModelPortaliQ4U4S6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati308 – 323Xin 1Add BLAST16
Repeati343 – 358Xin 2Add BLAST16
Repeati383 – 398Xin 3Add BLAST16
Repeati420 – 435Xin 4Add BLAST16
Repeati458 – 473Xin 5Add BLAST16
Repeati498 – 513Xin 6Add BLAST16
Repeati536 – 551Xin 7Add BLAST16
Repeati574 – 589Xin 8Add BLAST16
Repeati608 – 623Xin 9Add BLAST16
Repeati642 – 657Xin 10Add BLAST16
Repeati679 – 694Xin 11Add BLAST16
Repeati715 – 730Xin 12Add BLAST16
Repeati746 – 761Xin 13Add BLAST16
Repeati784 – 799Xin 14Add BLAST16
Repeati822 – 837Xin 15Add BLAST16
Repeati861 – 876Xin 16Add BLAST16
Repeati894 – 909Xin 17Add BLAST16
Repeati932 – 947Xin 18Add BLAST16
Repeati967 – 982Xin 19Add BLAST16
Repeati1006 – 1021Xin 20Add BLAST16
Repeati1042 – 1057Xin 21Add BLAST16
Repeati1079 – 1094Xin 22Add BLAST16
Repeati1117 – 1132Xin 23Add BLAST16
Repeati1154 – 1169Xin 24Add BLAST16
Repeati1188 – 1203Xin 25Add BLAST16
Repeati1219 – 1234Xin 26Add BLAST16
Repeati1256 – 1271Xin 27Add BLAST16
Repeati1291 – 1306Xin 28Add BLAST16
Domaini3255 – 3315LIM zinc-bindingPROSITE-ProRule annotationAdd BLAST61

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili2285 – 2333Sequence analysisAdd BLAST49
Coiled coili2683 – 2711Sequence analysisAdd BLAST29
Coiled coili2739 – 2767Sequence analysisAdd BLAST29
Coiled coili3043 – 3075Sequence analysisAdd BLAST33

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi125 – 128Poly-Glu4
Compositional biasi224 – 228Poly-Pro5
Compositional biasi2033 – 2123Pro-richAdd BLAST91
Compositional biasi3549 – 3556Poly-Asn8

Domaini

Xin repeats bind F-actin.

Sequence similaritiesi

Belongs to the Xin family.PROSITE-ProRule annotation
Contains 1 LIM zinc-binding domain.PROSITE-ProRule annotation
Contains 28 Xin repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, LIM domain, Repeat

Phylogenomic databases

eggNOGiENOG410ITHY. Eukaryota.
ENOG41125TA. LUCA.
GeneTreeiENSGT00530000063779.
HOVERGENiHBG108682.
InParanoidiQ4U4S6.
OMAiRYMFETQ.
OrthoDBiEOG091G0043.
PhylomeDBiQ4U4S6.
TreeFamiTF330745.

Family and domain databases

Gene3Di2.10.110.10. 1 hit.
InterProiIPR012510. Actin-binding_Xin_repeat.
IPR030072. XIRP1/XIRP2.
IPR030107. XIRP2.
IPR001781. Znf_LIM.
[Graphical view]
PANTHERiPTHR22591. PTHR22591. 1 hit.
PTHR22591:SF1. PTHR22591:SF1. 1 hit.
PfamiPF00412. LIM. 1 hit.
PF08043. Xin. 19 hits.
[Graphical view]
SMARTiSM00132. LIM. 1 hit.
[Graphical view]
PROSITEiPS00478. LIM_DOMAIN_1. 1 hit.
PS50023. LIM_DOMAIN_2. 1 hit.
PS51389. XIN. 28 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q4U4S6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MARYQAAVSR GDTRSFSANV MEESDVCTVP GGLAKMKRQF EKDKMTSTCN
60 70 80 90 100
AFSEYQYRHE SRAEQEAIHS SQEIIRRNEQ EVSKGHGTDV FKAEMMSHLE
110 120 130 140 150
KHTEETKQAS QFHQYVQETV IDSPEEEELP KVSTKILKEQ FEKSAQENFL
160 170 180 190 200
RSDKETSPPA KCMKIENDIE ETLKPSSAVG TSSSYTSTRQ RKETSTSSYS
210 220 230 240 250
NHSLTSTTLA QDNGTPSGKM EEFPPPPPDV CQTPMDVTAF SQSPEFPSPP
260 270 280 290 300
RRLPMPKDLY SKQRNLYELN RLYRHIHPEL RKNLEKDYIS EVSEIVSSQI
310 320 330 340 350
NSGNALSADV QKARYVFENT NDSSQKDLNS ERENLEWDEI LKGEVQSIRW
360 370 380 390 400
IFENQPLDSI NHGSTDEGYT SKGIADQELI AGSDVKYTTW MFETQPIDAL
410 420 430 440 450
GIPSAGTEGN TEKIPELARG DVYTARWMFE TRPLDSMNKM HECQEETAST
460 470 480 490 500
LTKDITGGDV KTVRYMFETQ QLDQLGQLHS VDELNLLQLR SELKEIKGNV
510 520 530 540 550
KRSIKCFETQ PLYVIRDGSG QMLEIKTVQR EDIEKGDVRT ARWMFETQPL
560 570 580 590 600
DTINKDITEI KVVRGISMEE NVKGGVSRAK WLFETQPLEK IKEESGEAVL
610 620 630 640 650
KTEAVIGTDV SKKCWMFETQ PLDILKDSPD TDSVSPEERI GGDVKTTKHL
660 670 680 690 700
FETLPIEALK DSPDIGKLQK ITASEEEKGD VKHQKWVFET QRLEDIREDK
710 720 730 740 750
KEYTRTVRLE AVDRGHVKNY THIFESNNLI KVDASHQIEV EGVTRGTVEL
760 770 780 790 800
NKSLFETTPL YAIQDHLGKY HQVKTVQQEE IVRGDVRSCR WLFETRPIDQ
810 820 830 840 850
FDESLHKFQI IRGISAQEIQ AGNVKSARWL FETQPLDSIK YFSNVEETDS
860 870 880 890 900
KTEQSTDIVK GDVKTCKWLF ETQPMESLYE KASLMTNSED IHKGDVRTCM
910 920 930 940 950
WLFETQPLDA IKDDSEATVK LQTVKQEEIQ GGDVQTACFL FETENLDNIQ
960 970 980 990 1000
GDEGKENKPL EMDIQSGDVS GMKFKFENQS LDSINCSSEN VLSKIKTLKA
1010 1020 1030 1040 1050
EDIQKGNVLK CRWLFENQPI DMIKESQECD GLVKTVTDVQ GGDVRKGCFI
1060 1070 1080 1090 1100
FETFSLDEIK DESDGISMRE TNLGEIIKGD VKSYKMLFET QPLYAIQDHE
1110 1120 1130 1140 1150
GFYHEVTTVK KEETIHGDVR GTRWLFETKP LDSIHESEDV YVIKSVTQED
1160 1170 1180 1190 1200
IQKGDVSSVR YRFETQPLDM ISDKSHNIVP TVDYIQGGNV QMNKQLFESE
1210 1220 1230 1240 1250
GGNKKNYVRT VSVNEIQKGN VKTSTWLFET HRIDELGEES RYENIKTVTQ
1260 1270 1280 1290 1300
EDVQKGDVKQ AVWLFENQTL DSINELDEND TKMTKEEIPP SDVKTTTWLF
1310 1320 1330 1340 1350
ETTPIHEFNK TRVEKEEIIG KSIKETLEDL YSQRVVEAPG IIIEADEVGD
1360 1370 1380 1390 1400
VRMAKYKLMN QTTPEIQKEE VIRADLGNIM MNLLSQRDCT KKEIFVSEEE
1410 1420 1430 1440 1450
KGNVNFTKTQ LLNRSMEFHA EKEEIVRGDV KQAIQKLFSE ERRAKKGILI
1460 1470 1480 1490 1500
QEDEKGDINM TIYCLLHENA GDKTEREDIL GGDVRRTIHN LLSSASNGKI
1510 1520 1530 1540 1550
SERTKIDASE RGNVQFFTTC IETGALDYLK QLQTGSNEST LTASKQEGEE
1560 1570 1580 1590 1600
EIIGGDVEGT KFLLKKRQSS FERTVSETDI IPGDVRHTVK VFMTEPQSSS
1610 1620 1630 1640 1650
YKTVKDEIIK GDLKSTLNSL NQAMNQKTVA KAEEIVKDDR LAILKSLKES
1660 1670 1680 1690 1700
GDRQKEPKQS GGMSRDIGQA IECLERATNT RTEILKKELI LDDLKTSLRS
1710 1720 1730 1740 1750
LKEEQCGFKE VDKQGIVKDV LPGMLGFSER PKIGIHPAAV QRDKKSLLQP
1760 1770 1780 1790 1800
VPGPFEPAIK QQAGPGTLDE TTQKPCLRSL IEERTEANLP KAPKGTVKIV
1810 1820 1830 1840 1850
IDREQNNDAL EKSLRKMSNS EHRAMKNVLD MSDRMGIWTE SKEYLCSDDH
1860 1870 1880 1890 1900
MSKHLSATMS IKESLKSKES ENMREAKDDV ISSTQSVDKT FRKQQTQTCE
1910 1920 1930 1940 1950
LGNDQKSRFQ DSYGKNQKNI QNIEITRDFQ KQALLSQEKQ YSNKEMKKNE
1960 1970 1980 1990 2000
ASLQPLPVGK EVHSVPGVTV SGKNHKRIQA TDKRQKTDVC LESQDFLMKT
2010 2020 2030 2040 2050
NTSKELKMAM ERSFNPINLH PECGIKENED SLPPPSPPPL PPSNASSEIE
2060 2070 2080 2090 2100
FPLPPPPPLM LLPGKNESPP SSPTEKTRTE FESLSTLPLP PPPVDEKAEQ
2110 2120 2130 2140 2150
ECLSTTLPPP PPPTPCQPGH LLPSSVLGHH REAFLQQFSQ KEALGVHLPH
2160 2170 2180 2190 2200
SQAKILTGKS PPPTLPKPKL PKRIKDKMNQ YSSSGELERS LSDVEIKATL
2210 2220 2230 2240 2250
SKDQKRSMVT MSSEHRETKQ DVFGKGLVGR KQLPVDSANS LSQTVPEIPA
2260 2270 2280 2290 2300
PKEKQTAPLV KSHSFPSGSE QQSPKPYMRK FKTPLMIAEE KYRQQREELE
2310 2320 2330 2340 2350
KQRQESSSHN VIKTETQHQS LSEKEEEIEL QKATEAISTP RKESDFPRAR
2360 2370 2380 2390 2400
PNLDSESRAV IAGECSESQL ATASTLTVAT ERLQHVLAAS EDELTLRQEG
2410 2420 2430 2440 2450
IQNSSDASQS KLACETSQSH KECKAQQTFE QHVKRLPFPQ TKPSSPSFKV
2460 2470 2480 2490 2500
KTIKLSTLDH TGTETDLSSK HHTKQSEVDI QTSTEQTDKE IKKTQASIQC
2510 2520 2530 2540 2550
DDKPSVPEKY FQLPKTEKRV TIQMPKEYAE KSHKSKLQTV PKKQGIFGEF
2560 2570 2580 2590 2600
DRGNVLGREG KNQDSSVSCS KEDRLIDERK QEHLQNQRVP RSVQQKVINE
2610 2620 2630 2640 2650
RLDSQMQNFQ QTEIQTSRST IECEEFSQSY NATQEKTCLK DKGKQQGQVT
2660 2670 2680 2690 2700
SNTEESKQEL RQNQSAFSSV KDSQHDDGKC TINILEFLRK REELQQILSR
2710 2720 2730 2740 2750
VKQFEAESSK SGLKTFQILL NIVPVWLISE EKREYGVRVA MENNFEKVKE
2760 2770 2780 2790 2800
EITHIKTQAE EMLLQCEHVI QTAMMASQTG KQRDKPTNLN EMPLNVSNVN
2810 2820 2830 2840 2850
LSSSKCTEQK ESKTVEEKLT HRQVTTHPEA ATRNPVKPYQ EAKGEDGKMA
2860 2870 2880 2890 2900
PPSLKTRPPS PTFITIESTA RRAETSTKSE LSQSPKNNRC IEPPPRRPVE
2910 2920 2930 2940 2950
HASGLPRSRT PPSPPRSRSE QLVRLKDTTA RLAKGTIPCS PGTPVPIVEK
2960 2970 2980 2990 3000
RSEVVMSPAT LRRQIKIESR GGDSPPTITI PVSVNHVVSG SFRESVDAQE
3010 3020 3030 3040 3050
AVKKTEKTET YVHKDKMNSV NRAMPETESY DAVEIIRKVE GPHLSEHTER
3060 3070 3080 3090 3100
FEATNQTVQR AERFLNGHEN EINRWFREFE NDPVFRAKTE RGAYANGEIN
3110 3120 3130 3140 3150
HNMKQESHTF CKEEFGLASS ETANFTGFSY RHPKVPAMQP RVHSEARSLN
3160 3170 3180 3190 3200
EHFSSVDAFD SQIVGSKVAT SSSRSTEAGR SGFDFKHAPP TYEDVISGHI
3210 3220 3230 3240 3250
LDVADSPTNL RRNFQKTWQE SERVFQRVGY ETSDAHATEM SRAFQEESAF
3260 3270 3280 3290 3300
LSDKEICIIC QKTVYPMECL IADKQNFHKS CFRCHHCSSK LSLGNYASLH
3310 3320 3330 3340 3350
GRIYCKPHFK QLFKSKGNYD EGFGHKQHKD RWNCKNQSSL VDFIPSGEPD
3360 3370 3380 3390 3400
AHENPTADTL LLGDLTTHPD ACNSKRQDND LRKWGDRGKL KIVWPPCQEM
3410 3420 3430 3440 3450
PKKNSPPEEE FKVNKAKWPP EVTIPVPSDF KRESLTEHVK TLESQGQEQD
3460 3470 3480 3490 3500
SVPDLQPCKH VCQKEDITGI KEIKGYEERK DEKEAKDTLK DAEGLRSKRK
3510 3520 3530 3540 3550
SGMEFNDHNA HAQSDGKEKN ALVNEADSAD VLQVANTDDE GGPENHRENF
3560 3570 3580 3590 3600
NNNNNNSVAV SSLNNGRQKI SISERPRLLQ AVSEANYYTS EYQIKNFNNA
3610 3620 3630 3640 3650
SKISELLGIF ESQKLSSKKV LALALERTAD RGTAGSPLQL VLEPGLQQGF
3660 3670 3680 3690 3700
SVKGENLAAS PDVSPLHIKG NHENNKNVHL FFSNTVKITS FSKKHNILGC
3710 3720 3730 3740 3750
DLMDSVDQLK NMSCLYLREL GKNVKCWHGE TAGAARHGGK MCFDAQSQGS
3760 3770 3780
AAKPVFPSMQ CQAQHLTVEE QIKRDRCYSD SEAD
Length:3,784
Mass (Da):428,259
Last modified:July 5, 2005 - v1
Checksum:iC95FD2E0AD5CEBBC
GO
Isoform 2 (identifier: Q4U4S6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3253-3551: DKEICIICQK...GPENHRENFN → ETVGPRQGNLHNLSKDSLSNGVPHSRQAEFS
     3552-3784: Missing.

Show »
Length:3,283
Mass (Da):371,929
Checksum:i1AFEC6DE2CB999D1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti44K → E in AAV52766 (PubMed:17766470).Curated1
Sequence conflicti721T → A in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti837D → G in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti1633E → G in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti2114T → A in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti2179N → S in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti2408S → P in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti2457T → A in ABL63748 (PubMed:17046827).Curated1
Sequence conflicti2784D → G in ABL63748 (PubMed:17046827).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0308493253 – 3551DKEIC…RENFN → ETVGPRQGNLHNLSKDSLSN GVPHSRQAEFS in isoform 2. 2 PublicationsAdd BLAST299
Alternative sequenceiVSP_0308503552 – 3784Missing in isoform 2. 2 PublicationsAdd BLAST233

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EF122140 mRNA. Translation: ABL63748.1.
DQ011666 mRNA. Translation: AAY44537.1.
EF119716 mRNA. Translation: ABO69252.1.
AL929411 Genomic DNA. Translation: CAM21906.1.
AY775570 mRNA. Translation: AAV52766.1.
AY775571 mRNA. Translation: AAV52767.1.
AY775572 mRNA. Translation: AAV52768.1.
AK040786 mRNA. Translation: BAC30703.1.
CCDSiCCDS16082.1. [Q4U4S6-1]
CCDS38133.1. [Q4U4S6-2]
RefSeqiNP_001019789.1. NM_001024618.2. [Q4U4S6-1]
NP_001077388.1. NM_001083919.1. [Q4U4S6-2]
UniGeneiMm.261043.

Genome annotation databases

EnsembliENSMUST00000028410; ENSMUSP00000028410; ENSMUSG00000027022. [Q4U4S6-1]
ENSMUST00000112347; ENSMUSP00000107966; ENSMUSG00000027022. [Q4U4S6-2]
GeneIDi241431.
KEGGimmu:241431.
UCSCiuc008jxj.1. mouse. [Q4U4S6-2]
uc008jxk.1. mouse. [Q4U4S6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EF122140 mRNA. Translation: ABL63748.1.
DQ011666 mRNA. Translation: AAY44537.1.
EF119716 mRNA. Translation: ABO69252.1.
AL929411 Genomic DNA. Translation: CAM21906.1.
AY775570 mRNA. Translation: AAV52766.1.
AY775571 mRNA. Translation: AAV52767.1.
AY775572 mRNA. Translation: AAV52768.1.
AK040786 mRNA. Translation: BAC30703.1.
CCDSiCCDS16082.1. [Q4U4S6-1]
CCDS38133.1. [Q4U4S6-2]
RefSeqiNP_001019789.1. NM_001024618.2. [Q4U4S6-1]
NP_001077388.1. NM_001083919.1. [Q4U4S6-2]
UniGeneiMm.261043.

3D structure databases

ProteinModelPortaliQ4U4S6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi232312. 1 interactor.
IntActiQ4U4S6. 1 interactor.
STRINGi10090.ENSMUSP00000028410.

PTM databases

iPTMnetiQ4U4S6.
PhosphoSitePlusiQ4U4S6.

Proteomic databases

PaxDbiQ4U4S6.
PRIDEiQ4U4S6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000028410; ENSMUSP00000028410; ENSMUSG00000027022. [Q4U4S6-1]
ENSMUST00000112347; ENSMUSP00000107966; ENSMUSG00000027022. [Q4U4S6-2]
GeneIDi241431.
KEGGimmu:241431.
UCSCiuc008jxj.1. mouse. [Q4U4S6-2]
uc008jxk.1. mouse. [Q4U4S6-1]

Organism-specific databases

CTDi129446.
MGIiMGI:2685198. Xirp2.

Phylogenomic databases

eggNOGiENOG410ITHY. Eukaryota.
ENOG41125TA. LUCA.
GeneTreeiENSGT00530000063779.
HOVERGENiHBG108682.
InParanoidiQ4U4S6.
OMAiRYMFETQ.
OrthoDBiEOG091G0043.
PhylomeDBiQ4U4S6.
TreeFamiTF330745.

Miscellaneous databases

PROiQ4U4S6.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000027022.
CleanExiMM_XIRP2.

Family and domain databases

Gene3Di2.10.110.10. 1 hit.
InterProiIPR012510. Actin-binding_Xin_repeat.
IPR030072. XIRP1/XIRP2.
IPR030107. XIRP2.
IPR001781. Znf_LIM.
[Graphical view]
PANTHERiPTHR22591. PTHR22591. 1 hit.
PTHR22591:SF1. PTHR22591:SF1. 1 hit.
PfamiPF00412. LIM. 1 hit.
PF08043. Xin. 19 hits.
[Graphical view]
SMARTiSM00132. LIM. 1 hit.
[Graphical view]
PROSITEiPS00478. LIM_DOMAIN_1. 1 hit.
PS50023. LIM_DOMAIN_2. 1 hit.
PS51389. XIN. 28 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiXIRP2_MOUSE
AccessioniPrimary (citable) accession number: Q4U4S6
Secondary accession number(s): A1ECA5
, A2AVA2, Q5S4P6, Q5S4P7, Q5S4P8, Q8BS23
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: July 5, 2005
Last modified: November 30, 2016
This is version 81 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.