Reviewed,
UniProtKB/Swiss-Prot Q4R381 (EZH2_MACFA)
Last modified
June 16, 2009.
Version 20.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Histone-lysine N-methyltransferase EZH2 EC=2.1.1.43 Alternative name(s): Enhancer of zeste homolog 2 | ||||
| Gene names |
| ||||
| Organism | Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey) | ||||
| Taxonomic identifier | 9541 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Cercopithecidae › Cercopithecinae › Macaca |
Protein attributes
| Sequence length | 746 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Compared to EZH2-containing complexes, it is more abundant in embryonic stem cells and plays a major role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems By similarity. |
| Catalytic activity | S-adenosyl-L-methionine + histone L-lysine = S-adenosyl-L-homocysteine + histone N(6)-methyl-L-lysine. |
| Subunit structure | Component of the PRC2/EED-EZH2 complex, which includes EED, EZH2, SUZ12, RBBP4 and RBBP7 and possibly AEBP2 By similarity. The minimum components required for methyltransferase activity of the PRC2/EED-EZH2 complex are EED, EZH2 and SUZ12 By similarity. The PRC2 complex may also interact with DNMT1, DNMT3A, DNMT3B and PHF1 via the EZH2 subunit and with SIRT1 via the SUZ12 subunit By similarity. Interacts with HDAC1 and HDAC2 By similarity. Binds ATRX via the SET domain Probable. |
| Subcellular location | Nucleus By similarity. |
| Post-translational modification | Phosphorylated by AKT1 By similarity. Phosphorylation by AKT1 reduces methyltransferase activity By similarity. |
| Sequence similarities | Belongs to the histone-lysine methyltransferase family. EZ subfamily. Contains 1 SET domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | S-adenosyl-L-methionine |
| Molecular function | Chromatin regulator Methyltransferase Repressor Transferase |
| PTM | Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | chromatin modification Inferred from electronic annotation. Source: UniProtKB-KW regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcriptionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | DNA binding Inferred from electronic annotation. Source: InterPro histone-lysine N-methyltransferase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q4R381-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q4R381-2) The sequence of this isoform differs from the canonical sequence as follows: 74-82: Missing. 511-553: DGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSEC → G | ||||||
| Note: No expeirmental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 746 | 746 | Histone-lysine N-methyltransferase EZH2 | PRO_0000345426 | |||||
Regions | |||||||||
| Domain | 611 – 731 | 121 | SET | ||||||
| Region | 1 – 340 | 340 | Interaction with DNMT1, DNMT3A and DNMT3B By similarity | ||||||
| Region | 39 – 68 | 30 | Interaction with EED By similarity | ||||||
| Compositional bias | 183 – 209 | 27 | Asp-rich | ||||||
| Compositional bias | 523 – 588 | 66 | Cys-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 21 | 1 | Phosphoserine; by PKB/AKT1 By similarity | ||||||
| Modified residue | 339 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 366 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 367 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 380 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 487 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 74 – 82 | 9 | Missing in isoform 2. | VSP_034951 | |||||
| Alternative sequence | 511 – 553 | 43 | DGSSN…CSSEC → G in isoform 2. | VSP_034952 | |||||
Experimental info | |||||||||
| Sequence conflict | 305 | 1 | A → T in BAE01042. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "DNA sequences of macaque genes expressed in brain or testis and its evolutionary implications." International consortium for macaque cDNA sequencing and analysis Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Testis. |
Cross-references
Sequence databases | |
|---|---|
| AB168941 mRNA. Translation: BAE01042.1. AB179385 mRNA. Translation: BAE02436.1. | |
3D structure databases | |
| ModBase | Search... |
Phylogenomic databases | |
| HOVERGEN | Q4R381. |
Family and domain databases | |
| InterPro | IPR001005. SANT_DNA-bd. IPR001214. SET. [Graphical view] |
| Pfam | PF00856. SET. 1 hit. [Graphical view] |
| SMART | SM00717. SANT. 2 hits. SM00317. SET. 1 hit. [Graphical view] |
| PROSITE | PS50280. SET. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | EZH2_MACFA | ||||||||
| Accession | Primary (citable) accession number: Q4R381 Secondary accession number(s): Q4R780 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||

Clusters with


