Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Queuine tRNA-ribosyltransferase

Gene

Qtrt1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Interacts with QTRTD1 to form an active queuine tRNA-ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GUN anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine) (By similarity).By similarity

Catalytic activityi

Guanine(34) in tRNA + queuine = queuosine(34) in tRNA + guanine.

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Pathwayi: tRNA-queuosine biosynthesis

This protein is involved in the pathway tRNA-queuosine biosynthesis, which is part of tRNA modification.
View all proteins of this organism that are known to be involved in the pathway tRNA-queuosine biosynthesis and in tRNA modification.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei106 – 1061SubstrateBy similarity
Active sitei279 – 2791NucleophileBy similarity
Metal bindingi317 – 3171ZincBy similarity
Metal bindingi319 – 3191ZincBy similarity
Metal bindingi322 – 3221ZincBy similarity
Metal bindingi348 – 3481ZincBy similarity

GO - Molecular functioni

  • metal ion binding Source: UniProtKB-KW
  • queuine tRNA-ribosyltransferase activity Source: RGD

GO - Biological processi

  • queuosine biosynthetic process Source: RGD
  • tRNA modification Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Keywords - Biological processi

Queuosine biosynthesis, tRNA processing

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00392.

Names & Taxonomyi

Protein namesi
Recommended name:
Queuine tRNA-ribosyltransferase (EC:2.4.2.29)
Alternative name(s):
Guanine insertion enzyme
tRNA-guanine transglycosylase
Gene namesi
Name:Qtrt1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi620996. Qtrt1.

Subcellular locationi

  • Cytoplasm By similarity
  • Mitochondrion By similarity
  • Nucleus By similarity

  • Note: Weakly associates with mitochondria, possibly via QTRTD1.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Mitochondrion, Nucleus

Pathology & Biotechi

Chemistry

ChEMBLiCHEMBL4395.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 403402Queuine tRNA-ribosyltransferasePRO_0000383946Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanineBy similarity

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ4QR99.
PRIDEiQ4QR99.

Expressioni

Gene expression databases

GenevisibleiQ4QR99. RN.

Interactioni

Subunit structurei

Interacts with QTRTD1.By similarity

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000010030.

Structurei

3D structure databases

ProteinModelPortaliQ4QR99.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3908. Eukaryota.
COG0343. LUCA.
HOGENOMiHOG000223473.
InParanoidiQ4QR99.
KOiK00773.
OMAiMRENITN.
OrthoDBiEOG7W41BR.
PhylomeDBiQ4QR99.
TreeFamiTF300732.

Family and domain databases

Gene3Di3.20.20.105. 1 hit.
HAMAPiMF_00168. Q_tRNA_Tgt.
InterProiIPR004803. Queuine_tRNA-ribosylTrfase.
IPR002616. tRNA_ribo_trans-like.
[Graphical view]
PfamiPF01702. TGT. 1 hit.
[Graphical view]
SUPFAMiSSF51713. SSF51713. 1 hit.
TIGRFAMsiTIGR00430. Q_tRNA_tgt. 1 hit.
TIGR00449. tgt_general. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q4QR99-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAVGSPGSL ESAPRIMRLV AECSRSRARA GELRLPHGTV ATPVFMPVGT
60 70 80 90 100
QATMKGITAE QLDSLGCRIC LGNTYHLGLR PGPELIQKAH GLHGFMNWPH
110 120 130 140 150
NLLTDSGGFQ MVSLISLSEV TEEGVRFRSP YDGEETLLSP ERSVEIQNAL
160 170 180 190 200
GSDIIMQLDD VVSSTVTGPR VEEAMHRSVR WLDRCIAAHK RQDKQNLFAI
210 220 230 240 250
IQGGLNADLR TTCLKEMTKR DVPGFAIGGL SGGESKEQFW KMVALSTSML
260 270 280 290 300
PKDKPRYLMG VGYATDLVVC VALGCDMFDC VYPTRTARFG SALVPTGNLQ
310 320 330 340 350
LKKQQYAKDF SPINPECPCA TCQTHSRAFL HTLLHSDNTA ALHHLTVHNI
360 370 380 390 400
AYQLQLLSAA RSSILEQRFP DFVRNFMRTM YGDHSLCPAW AIEALASVGI

TLT
Length:403
Mass (Da):44,187
Last modified:July 19, 2005 - v1
Checksum:iA60C00474906A9F8
GO
Isoform 2 (identifier: Q4QR99-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     354-403: LQLLSAARSSILEQRFPDFVRNFMRTMYGDHSLCPAWAIEALASVGITLT → VTWMDMVWGREGLGSQGRVG

Note: No experimental confirmation available.
Show »
Length:373
Mass (Da):40,810
Checksum:iF5F6ABB52E96EEDA
GO

Sequence cautioni

The sequence BAA93552.1 differs from that shown. Reason: Frameshift at position 1. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei354 – 40350LQLLS…GITLT → VTWMDMVWGREGLGSQGRVG in isoform 2. 1 PublicationVSP_038056Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB034634 mRNA. Translation: BAA93552.1. Frameshift.
BC097321 mRNA. Translation: AAH97321.1.
RefSeqiNP_071586.2. NM_022250.2. [Q4QR99-1]
UniGeneiRn.53858.

Genome annotation databases

GeneIDi64016.
KEGGirno:64016.
UCSCiRGD:620996. rat. [Q4QR99-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB034634 mRNA. Translation: BAA93552.1. Frameshift.
BC097321 mRNA. Translation: AAH97321.1.
RefSeqiNP_071586.2. NM_022250.2. [Q4QR99-1]
UniGeneiRn.53858.

3D structure databases

ProteinModelPortaliQ4QR99.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000010030.

Chemistry

ChEMBLiCHEMBL4395.

Proteomic databases

PaxDbiQ4QR99.
PRIDEiQ4QR99.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi64016.
KEGGirno:64016.
UCSCiRGD:620996. rat. [Q4QR99-1]

Organism-specific databases

CTDi81890.
RGDi620996. Qtrt1.

Phylogenomic databases

eggNOGiKOG3908. Eukaryota.
COG0343. LUCA.
HOGENOMiHOG000223473.
InParanoidiQ4QR99.
KOiK00773.
OMAiMRENITN.
OrthoDBiEOG7W41BR.
PhylomeDBiQ4QR99.
TreeFamiTF300732.

Enzyme and pathway databases

UniPathwayiUPA00392.

Miscellaneous databases

NextBioi612598.
PROiQ4QR99.

Gene expression databases

GenevisibleiQ4QR99. RN.

Family and domain databases

Gene3Di3.20.20.105. 1 hit.
HAMAPiMF_00168. Q_tRNA_Tgt.
InterProiIPR004803. Queuine_tRNA-ribosylTrfase.
IPR002616. tRNA_ribo_trans-like.
[Graphical view]
PfamiPF01702. TGT. 1 hit.
[Graphical view]
SUPFAMiSSF51713. SSF51713. 1 hit.
TIGRFAMsiTIGR00430. Q_tRNA_tgt. 1 hit.
TIGR00449. tgt_general. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Rat tRNA-guanine transglycosylase (TGT)."
    Hidaka T., Morishita T.
    Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Thymus.

Entry informationi

Entry nameiTGT_RAT
AccessioniPrimary (citable) accession number: Q4QR99
Secondary accession number(s): Q9JMA0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 22, 2009
Last sequence update: July 19, 2005
Last modified: May 11, 2016
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.