Q4QQU6 (SPF30_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 61.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Survival of motor neuron-related-splicing factor 30 Alternative name(s): Survival motor neuron domain-containing protein 1 | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 238 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Necessary for spliceosome assembly. Overexpression causes apoptosis By similarity. |
| Subunit structure | Associates with spliceosomes. Associates with U4/U5/U6 tri-snRNP and with U2 snRNP By similarity. |
| Subcellular location | Nucleus speckle By similarity. Nucleus › Cajal body By similarity. Note: Detected in nuclear speckles containing snRNP and in Cajal (coiled) bodies By similarity. |
| Domain | The Tudor domain mediates association with dimethylarginines, which are common in snRNP proteins By similarity. |
| Sequence similarities | Belongs to the SMN family. Contains 1 Tudor domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis mRNA processing mRNA splicing |
| Cellular component | Nucleus Spliceosome |
| Coding sequence diversity | Alternative splicing |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | RNA splicing Inferred from electronic annotation. Source: UniProtKB-KW apoptotic processInferred from electronic annotation. Source: UniProtKB-KW mRNA processingInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | Cajal body Inferred from electronic annotation. Source: UniProtKB-SubCell cytoplasmInferred from electronic annotation. Source: InterPro nuclear speckInferred from electronic annotation. Source: UniProtKB-SubCell spliceosomal complexInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | RNA binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q4QQU6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q4QQU6-2) The sequence of this isoform differs from the canonical sequence as follows: 88-238: QCYEAEIEEI...KYNVRHLMPQ → HHDIFTGVMRRRSRRSMKRTAPLRSPSLSMAMPK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 238 | 238 | Survival of motor neuron-related-splicing factor 30 | PRO_0000347224 | |||||
Regions | |||||||||
| Domain | 72 – 132 | 61 | Tudor | ||||||
| Motif | 142 – 160 | 19 | Nuclear localization signal Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 201 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 219 | 1 | N6-acetyllysine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 88 – 238 | 151 | QCYEA…HLMPQ → HHDIFTGVMRRRSRRSMKRT APLRSPSLSMAMPK in isoform 2. | VSP_035075 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Placenta and Thymus. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | BC097986 mRNA. Translation: AAH97986.1. BC098697 mRNA. Translation: AAH98697.1. |
| IPI | IPI00370325. IPI00627069. |
| RefSeq | NP_001020571.1. NM_001025400.3. NP_001030311.1. NM_001035234.2. |
| UniGene | Rn.103854. |
3D structure databases | |
| ProteinModelPortal | Q4QQU6. |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | Q4QQU6. |
| PRIDE | Q4QQU6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000020539; ENSRNOP00000020539; ENSRNOG00000014833. |
| GeneID | 287768. |
| KEGG | rno:287768. |
Organism-specific databases | |
| CTD | 10285. |
| RGD | 1309151. Smndc1. |
Phylogenomic databases | |
| eggNOG | NOG251685. |
| GeneTree | ENSGT00560000077236. |
| HOGENOM | HOG000007521. |
| HOVERGEN | HBG057021. |
| InParanoid | Q4QQU6. |
| KO | K12839. |
| OMA | NNKAYSK. |
| OrthoDB | EOG4H464Q. |
Gene expression databases | |
| Genevestigator | Q4QQU6. |
Family and domain databases | |
| InterPro | IPR010304. Survival_motor_neuron. IPR002999. Tudor. [Graphical view] |
| Pfam | PF06003. SMN. 1 hit. [Graphical view] |
| SMART | SM00333. TUDOR. 1 hit. [Graphical view] |
| PROSITE | PS50304. TUDOR. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 626977. |
Entry information
| Entry name | SPF30_RAT | ||||||||
| Accession | Primary (citable) accession number: Q4QQU6 Secondary accession number(s): Q4KM88 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
