Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q4QQU6

- SPF30_RAT

UniProt

Q4QQU6 - SPF30_RAT

Protein

Survival of motor neuron-related-splicing factor 30

Gene

Smndc1

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 70 (01 Oct 2014)
      Sequence version 1 (19 Jul 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Necessary for spliceosome assembly. Overexpression causes apoptosis By similarity.By similarity

    GO - Molecular functioni

    1. RNA binding Source: InterPro

    GO - Biological processi

    1. apoptotic process Source: UniProtKB-KW
    2. mRNA processing Source: UniProtKB-KW
    3. RNA splicing Source: UniProtKB-KW

    Keywords - Biological processi

    Apoptosis, mRNA processing, mRNA splicing

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Survival of motor neuron-related-splicing factor 30
    Alternative name(s):
    Survival motor neuron domain-containing protein 1
    Gene namesi
    Name:Smndc1
    Synonyms:Spf30
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Chromosome 1

    Organism-specific databases

    RGDi1309151. Smndc1.

    Subcellular locationi

    Nucleus speckle By similarity. NucleusCajal body By similarity
    Note: Detected in nuclear speckles containing snRNP and in Cajal (coiled) bodies.By similarity

    GO - Cellular componenti

    1. Cajal body Source: UniProtKB-SubCell
    2. cytoplasm Source: InterPro
    3. nuclear speck Source: UniProtKB-SubCell
    4. spliceosomal complex Source: UniProtKB-KW

    Keywords - Cellular componenti

    Nucleus, Spliceosome

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 238238Survival of motor neuron-related-splicing factor 30PRO_0000347224Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei201 – 2011PhosphoserineBy similarity
    Modified residuei219 – 2191N6-acetyllysineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    PaxDbiQ4QQU6.
    PRIDEiQ4QQU6.

    Expressioni

    Gene expression databases

    GenevestigatoriQ4QQU6.

    Interactioni

    Subunit structurei

    Associates with spliceosomes. Associates with U4/U5/U6 tri-snRNP and with U2 snRNP By similarity.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ4QQU6.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini72 – 13261TudorPROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi142 – 16019Nuclear localization signalSequence AnalysisAdd
    BLAST

    Domaini

    The Tudor domain mediates association with dimethylarginines, which are common in snRNP proteins.By similarity

    Sequence similaritiesi

    Belongs to the SMN family.Curated
    Contains 1 Tudor domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG251685.
    GeneTreeiENSGT00730000111118.
    HOGENOMiHOG000007521.
    HOVERGENiHBG057021.
    InParanoidiQ4QQU6.
    KOiK12839.
    OMAiNNKAYSK.
    OrthoDBiEOG7K6PVX.
    PhylomeDBiQ4QQU6.
    TreeFamiTF315413.

    Family and domain databases

    InterProiIPR010304. Survival_motor_neuron.
    IPR002999. Tudor.
    [Graphical view]
    PfamiPF06003. SMN. 1 hit.
    [Graphical view]
    SMARTiSM00333. TUDOR. 1 hit.
    [Graphical view]
    PROSITEiPS50304. TUDOR. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q4QQU6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSEDLAKQLA SYKAQLQQVE AALSGNGENE DLLKLKKDLQ EVIELTKDLL    50
    STQPSETLTS SDSFASTQPT HSWKVGDKCM AVWSEDGQCY EAEIEEIDEE 100
    NGTAAITFAV YGNAEVTPLL NLKPVEEGRK AKEDSGNKPM SKKEMIAQQR 150
    EYKKKKALKK AQRIKELEQE REDQKVKWQQ FNNRAYSKNK KGQVKRSIFA 200
    SPESVTGKVG VGTCGIADKP MTQYQDTSKY NVRHLMPQ 238
    Length:238
    Mass (Da):26,783
    Last modified:July 19, 2005 - v1
    Checksum:i65C58A9564DE502F
    GO
    Isoform 2 (identifier: Q4QQU6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         88-238: QCYEAEIEEI...KYNVRHLMPQ → HHDIFTGVMRRRSRRSMKRTAPLRSPSLSMAMPK

    Note: No experimental confirmation available.

    Show »
    Length:121
    Mass (Da):13,522
    Checksum:iA52A9160BD3459B8
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei88 – 238151QCYEA…HLMPQ → HHDIFTGVMRRRSRRSMKRT APLRSPSLSMAMPK in isoform 2. 1 PublicationVSP_035075Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    BC097986 mRNA. Translation: AAH97986.1.
    BC098697 mRNA. Translation: AAH98697.1.
    RefSeqiNP_001020571.1. NM_001025400.3. [Q4QQU6-1]
    NP_001030311.1. NM_001035234.2. [Q4QQU6-1]
    UniGeneiRn.103854.

    Genome annotation databases

    EnsembliENSRNOT00000020539; ENSRNOP00000020539; ENSRNOG00000014833. [Q4QQU6-1]
    GeneIDi287768.
    KEGGirno:287768.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    BC097986 mRNA. Translation: AAH97986.1 .
    BC098697 mRNA. Translation: AAH98697.1 .
    RefSeqi NP_001020571.1. NM_001025400.3. [Q4QQU6-1 ]
    NP_001030311.1. NM_001035234.2. [Q4QQU6-1 ]
    UniGenei Rn.103854.

    3D structure databases

    ProteinModelPortali Q4QQU6.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PaxDbi Q4QQU6.
    PRIDEi Q4QQU6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSRNOT00000020539 ; ENSRNOP00000020539 ; ENSRNOG00000014833 . [Q4QQU6-1 ]
    GeneIDi 287768.
    KEGGi rno:287768.

    Organism-specific databases

    CTDi 10285.
    RGDi 1309151. Smndc1.

    Phylogenomic databases

    eggNOGi NOG251685.
    GeneTreei ENSGT00730000111118.
    HOGENOMi HOG000007521.
    HOVERGENi HBG057021.
    InParanoidi Q4QQU6.
    KOi K12839.
    OMAi NNKAYSK.
    OrthoDBi EOG7K6PVX.
    PhylomeDBi Q4QQU6.
    TreeFami TF315413.

    Miscellaneous databases

    NextBioi 626977.
    PROi Q4QQU6.

    Gene expression databases

    Genevestigatori Q4QQU6.

    Family and domain databases

    InterProi IPR010304. Survival_motor_neuron.
    IPR002999. Tudor.
    [Graphical view ]
    Pfami PF06003. SMN. 1 hit.
    [Graphical view ]
    SMARTi SM00333. TUDOR. 1 hit.
    [Graphical view ]
    PROSITEi PS50304. TUDOR. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Placenta and Thymus.

    Entry informationi

    Entry nameiSPF30_RAT
    AccessioniPrimary (citable) accession number: Q4QQU6
    Secondary accession number(s): Q4KM88
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 2, 2008
    Last sequence update: July 19, 2005
    Last modified: October 1, 2014
    This is version 70 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3