Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Survival of motor neuron-related-splicing factor 30

Gene

Smndc1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Necessary for spliceosome assembly. Overexpression causes apoptosis (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis, mRNA processing, mRNA splicing

Enzyme and pathway databases

ReactomeiR-RNO-72163. mRNA Splicing - Major Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Survival of motor neuron-related-splicing factor 30
Alternative name(s):
Survival motor neuron domain-containing protein 1
Gene namesi
Name:Smndc1
Synonyms:Spf30
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 1

Organism-specific databases

RGDi1309151. Smndc1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus, Spliceosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003472241 – 238Survival of motor neuron-related-splicing factor 30Add BLAST238

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei201PhosphoserineBy similarity1
Modified residuei219N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ4QQU6.
PRIDEiQ4QQU6.

PTM databases

iPTMnetiQ4QQU6.
PhosphoSitePlusiQ4QQU6.

Expressioni

Gene expression databases

BgeeiENSRNOG00000014833.
ExpressionAtlasiQ4QQU6. baseline and differential.
GenevisibleiQ4QQU6. RN.

Interactioni

Subunit structurei

Associates with spliceosomes. Associates with U4/U5/U6 tri-snRNP and with U2 snRNP (By similarity).By similarity

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000020539.

Structurei

3D structure databases

ProteinModelPortaliQ4QQU6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini72 – 132TudorPROSITE-ProRule annotationAdd BLAST61

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi142 – 160Nuclear localization signalSequence analysisAdd BLAST19

Domaini

The Tudor domain mediates association with dimethylarginines, which are common in snRNP proteins.By similarity

Sequence similaritiesi

Belongs to the SMN family.Curated
Contains 1 Tudor domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3026. Eukaryota.
ENOG4110IGD. LUCA.
GeneTreeiENSGT00730000111118.
HOGENOMiHOG000007521.
HOVERGENiHBG057021.
InParanoidiQ4QQU6.
KOiK12839.
OMAiQFNNKAY.
PhylomeDBiQ4QQU6.
TreeFamiTF315413.

Family and domain databases

InterProiIPR010304. Survival_motor_neuron.
IPR002999. Tudor.
[Graphical view]
PfamiPF06003. SMN. 1 hit.
[Graphical view]
SMARTiSM00333. TUDOR. 1 hit.
[Graphical view]
PROSITEiPS50304. TUDOR. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q4QQU6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEDLAKQLA SYKAQLQQVE AALSGNGENE DLLKLKKDLQ EVIELTKDLL
60 70 80 90 100
STQPSETLTS SDSFASTQPT HSWKVGDKCM AVWSEDGQCY EAEIEEIDEE
110 120 130 140 150
NGTAAITFAV YGNAEVTPLL NLKPVEEGRK AKEDSGNKPM SKKEMIAQQR
160 170 180 190 200
EYKKKKALKK AQRIKELEQE REDQKVKWQQ FNNRAYSKNK KGQVKRSIFA
210 220 230
SPESVTGKVG VGTCGIADKP MTQYQDTSKY NVRHLMPQ
Length:238
Mass (Da):26,783
Last modified:July 19, 2005 - v1
Checksum:i65C58A9564DE502F
GO
Isoform 2 (identifier: Q4QQU6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-238: QCYEAEIEEI...KYNVRHLMPQ → HHDIFTGVMRRRSRRSMKRTAPLRSPSLSMAMPK

Note: No experimental confirmation available.
Show »
Length:121
Mass (Da):13,522
Checksum:iA52A9160BD3459B8
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03507588 – 238QCYEA…HLMPQ → HHDIFTGVMRRRSRRSMKRT APLRSPSLSMAMPK in isoform 2. 1 PublicationAdd BLAST151

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC097986 mRNA. Translation: AAH97986.1.
BC098697 mRNA. Translation: AAH98697.1.
RefSeqiNP_001020571.1. NM_001025400.3. [Q4QQU6-1]
NP_001030311.1. NM_001035234.2. [Q4QQU6-1]
UniGeneiRn.103854.

Genome annotation databases

EnsembliENSRNOT00000020539; ENSRNOP00000020539; ENSRNOG00000014833. [Q4QQU6-1]
ENSRNOT00000076121; ENSRNOP00000068081; ENSRNOG00000014833. [Q4QQU6-2]
ENSRNOT00000078670; ENSRNOP00000071875; ENSRNOG00000014833. [Q4QQU6-1]
GeneIDi287768.
KEGGirno:287768.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC097986 mRNA. Translation: AAH97986.1.
BC098697 mRNA. Translation: AAH98697.1.
RefSeqiNP_001020571.1. NM_001025400.3. [Q4QQU6-1]
NP_001030311.1. NM_001035234.2. [Q4QQU6-1]
UniGeneiRn.103854.

3D structure databases

ProteinModelPortaliQ4QQU6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000020539.

PTM databases

iPTMnetiQ4QQU6.
PhosphoSitePlusiQ4QQU6.

Proteomic databases

PaxDbiQ4QQU6.
PRIDEiQ4QQU6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000020539; ENSRNOP00000020539; ENSRNOG00000014833. [Q4QQU6-1]
ENSRNOT00000076121; ENSRNOP00000068081; ENSRNOG00000014833. [Q4QQU6-2]
ENSRNOT00000078670; ENSRNOP00000071875; ENSRNOG00000014833. [Q4QQU6-1]
GeneIDi287768.
KEGGirno:287768.

Organism-specific databases

CTDi10285.
RGDi1309151. Smndc1.

Phylogenomic databases

eggNOGiKOG3026. Eukaryota.
ENOG4110IGD. LUCA.
GeneTreeiENSGT00730000111118.
HOGENOMiHOG000007521.
HOVERGENiHBG057021.
InParanoidiQ4QQU6.
KOiK12839.
OMAiQFNNKAY.
PhylomeDBiQ4QQU6.
TreeFamiTF315413.

Enzyme and pathway databases

ReactomeiR-RNO-72163. mRNA Splicing - Major Pathway.

Miscellaneous databases

PROiQ4QQU6.

Gene expression databases

BgeeiENSRNOG00000014833.
ExpressionAtlasiQ4QQU6. baseline and differential.
GenevisibleiQ4QQU6. RN.

Family and domain databases

InterProiIPR010304. Survival_motor_neuron.
IPR002999. Tudor.
[Graphical view]
PfamiPF06003. SMN. 1 hit.
[Graphical view]
SMARTiSM00333. TUDOR. 1 hit.
[Graphical view]
PROSITEiPS50304. TUDOR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSPF30_RAT
AccessioniPrimary (citable) accession number: Q4QQU6
Secondary accession number(s): Q4KM88
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 19, 2005
Last modified: November 2, 2016
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.