SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q4QQU6

- SPF30_RAT

UniProt

Q4QQU6 - SPF30_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Survival of motor neuron-related-splicing factor 30
Gene
Smndc1, Spf30
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Necessary for spliceosome assembly. Overexpression causes apoptosis By similarity.

GO - Molecular functioni

  1. RNA binding Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. RNA splicing Source: UniProtKB-KW
  2. apoptotic process Source: UniProtKB-KW
  3. mRNA processing Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Apoptosis, mRNA processing, mRNA splicing

Names & Taxonomyi

Protein namesi
Recommended name:
Survival of motor neuron-related-splicing factor 30
Alternative name(s):
Survival motor neuron domain-containing protein 1
Gene namesi
Name:Smndc1
Synonyms:Spf30
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Chromosome 1

Organism-specific databases

RGDi1309151. Smndc1.

Subcellular locationi

Nucleus speckle By similarity. NucleusCajal body By similarity
Note: Detected in nuclear speckles containing snRNP and in Cajal (coiled) bodies By similarity.

GO - Cellular componenti

  1. Cajal body Source: UniProtKB-SubCell
  2. cytoplasm Source: InterPro
  3. nuclear speck Source: UniProtKB-SubCell
  4. spliceosomal complex Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus, Spliceosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 238238Survival of motor neuron-related-splicing factor 30
PRO_0000347224Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei201 – 2011Phosphoserine By similarity
Modified residuei219 – 2191N6-acetyllysine By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ4QQU6.
PRIDEiQ4QQU6.

Expressioni

Gene expression databases

GenevestigatoriQ4QQU6.

Interactioni

Subunit structurei

Associates with spliceosomes. Associates with U4/U5/U6 tri-snRNP and with U2 snRNP By similarity.

Structurei

3D structure databases

ProteinModelPortaliQ4QQU6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini72 – 13261Tudor
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi142 – 16019Nuclear localization signal Reviewed prediction
Add
BLAST

Domaini

The Tudor domain mediates association with dimethylarginines, which are common in snRNP proteins By similarity.

Sequence similaritiesi

Belongs to the SMN family.
Contains 1 Tudor domain.

Phylogenomic databases

eggNOGiNOG251685.
GeneTreeiENSGT00730000111118.
HOGENOMiHOG000007521.
HOVERGENiHBG057021.
InParanoidiQ4QQU6.
KOiK12839.
OMAiNNKAYSK.
OrthoDBiEOG7K6PVX.
PhylomeDBiQ4QQU6.
TreeFamiTF315413.

Family and domain databases

InterProiIPR010304. Survival_motor_neuron.
IPR002999. Tudor.
[Graphical view]
PfamiPF06003. SMN. 1 hit.
[Graphical view]
SMARTiSM00333. TUDOR. 1 hit.
[Graphical view]
PROSITEiPS50304. TUDOR. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q4QQU6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSEDLAKQLA SYKAQLQQVE AALSGNGENE DLLKLKKDLQ EVIELTKDLL    50
STQPSETLTS SDSFASTQPT HSWKVGDKCM AVWSEDGQCY EAEIEEIDEE 100
NGTAAITFAV YGNAEVTPLL NLKPVEEGRK AKEDSGNKPM SKKEMIAQQR 150
EYKKKKALKK AQRIKELEQE REDQKVKWQQ FNNRAYSKNK KGQVKRSIFA 200
SPESVTGKVG VGTCGIADKP MTQYQDTSKY NVRHLMPQ 238
Length:238
Mass (Da):26,783
Last modified:July 19, 2005 - v1
Checksum:i65C58A9564DE502F
GO
Isoform 2 (identifier: Q4QQU6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-238: QCYEAEIEEI...KYNVRHLMPQ → HHDIFTGVMRRRSRRSMKRTAPLRSPSLSMAMPK

Note: No experimental confirmation available.

Show »
Length:121
Mass (Da):13,522
Checksum:iA52A9160BD3459B8
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei88 – 238151QCYEA…HLMPQ → HHDIFTGVMRRRSRRSMKRT APLRSPSLSMAMPK in isoform 2.
VSP_035075Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
BC097986 mRNA. Translation: AAH97986.1.
BC098697 mRNA. Translation: AAH98697.1.
RefSeqiNP_001020571.1. NM_001025400.3. [Q4QQU6-1]
NP_001030311.1. NM_001035234.2. [Q4QQU6-1]
UniGeneiRn.103854.

Genome annotation databases

EnsembliENSRNOT00000020539; ENSRNOP00000020539; ENSRNOG00000014833. [Q4QQU6-1]
GeneIDi287768.
KEGGirno:287768.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
BC097986 mRNA. Translation: AAH97986.1 .
BC098697 mRNA. Translation: AAH98697.1 .
RefSeqi NP_001020571.1. NM_001025400.3. [Q4QQU6-1 ]
NP_001030311.1. NM_001035234.2. [Q4QQU6-1 ]
UniGenei Rn.103854.

3D structure databases

ProteinModelPortali Q4QQU6.
ModBasei Search...

Proteomic databases

PaxDbi Q4QQU6.
PRIDEi Q4QQU6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSRNOT00000020539 ; ENSRNOP00000020539 ; ENSRNOG00000014833 . [Q4QQU6-1 ]
GeneIDi 287768.
KEGGi rno:287768.

Organism-specific databases

CTDi 10285.
RGDi 1309151. Smndc1.

Phylogenomic databases

eggNOGi NOG251685.
GeneTreei ENSGT00730000111118.
HOGENOMi HOG000007521.
HOVERGENi HBG057021.
InParanoidi Q4QQU6.
KOi K12839.
OMAi NNKAYSK.
OrthoDBi EOG7K6PVX.
PhylomeDBi Q4QQU6.
TreeFami TF315413.

Miscellaneous databases

NextBioi 626977.
PROi Q4QQU6.

Gene expression databases

Genevestigatori Q4QQU6.

Family and domain databases

InterProi IPR010304. Survival_motor_neuron.
IPR002999. Tudor.
[Graphical view ]
Pfami PF06003. SMN. 1 hit.
[Graphical view ]
SMARTi SM00333. TUDOR. 1 hit.
[Graphical view ]
PROSITEi PS50304. TUDOR. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Placenta and Thymus.

Entry informationi

Entry nameiSPF30_RAT
AccessioniPrimary (citable) accession number: Q4QQU6
Secondary accession number(s): Q4KM88
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 19, 2005
Last modified: July 9, 2014
This is version 69 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi