Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q4QQU6 (SPF30_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 67. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Survival of motor neuron-related-splicing factor 30
Alternative name(s):
Survival motor neuron domain-containing protein 1
Gene names
Name:Smndc1
Synonyms:Spf30
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length238 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Necessary for spliceosome assembly. Overexpression causes apoptosis By similarity.

Subunit structure

Associates with spliceosomes. Associates with U4/U5/U6 tri-snRNP and with U2 snRNP By similarity.

Subcellular location

Nucleus speckle By similarity. NucleusCajal body By similarity. Note: Detected in nuclear speckles containing snRNP and in Cajal (coiled) bodies By similarity.

Domain

The Tudor domain mediates association with dimethylarginines, which are common in snRNP proteins By similarity.

Sequence similarities

Belongs to the SMN family.

Contains 1 Tudor domain.

Ontologies

Keywords
   Biological processApoptosis
mRNA processing
mRNA splicing
   Cellular componentNucleus
Spliceosome
   Coding sequence diversityAlternative splicing
   PTMAcetylation
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processRNA splicing

Inferred from electronic annotation. Source: UniProtKB-KW

apoptotic process

Inferred from electronic annotation. Source: UniProtKB-KW

mRNA processing

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentCajal body

Inferred from electronic annotation. Source: UniProtKB-SubCell

cytoplasm

Inferred from electronic annotation. Source: InterPro

nuclear speck

Inferred from electronic annotation. Source: UniProtKB-SubCell

spliceosomal complex

Inferred from electronic annotation. Source: UniProtKB-KW

   Molecular_functionRNA binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q4QQU6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q4QQU6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     88-238: QCYEAEIEEI...KYNVRHLMPQ → HHDIFTGVMRRRSRRSMKRTAPLRSPSLSMAMPK
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 238238Survival of motor neuron-related-splicing factor 30
PRO_0000347224

Regions

Domain72 – 13261Tudor
Motif142 – 16019Nuclear localization signal Potential

Amino acid modifications

Modified residue2011Phosphoserine By similarity
Modified residue2191N6-acetyllysine By similarity

Natural variations

Alternative sequence88 – 238151QCYEA…HLMPQ → HHDIFTGVMRRRSRRSMKRT APLRSPSLSMAMPK in isoform 2.
VSP_035075

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 19, 2005. Version 1.
Checksum: 65C58A9564DE502F

FASTA23826,783
        10         20         30         40         50         60 
MSEDLAKQLA SYKAQLQQVE AALSGNGENE DLLKLKKDLQ EVIELTKDLL STQPSETLTS 

        70         80         90        100        110        120 
SDSFASTQPT HSWKVGDKCM AVWSEDGQCY EAEIEEIDEE NGTAAITFAV YGNAEVTPLL 

       130        140        150        160        170        180 
NLKPVEEGRK AKEDSGNKPM SKKEMIAQQR EYKKKKALKK AQRIKELEQE REDQKVKWQQ 

       190        200        210        220        230 
FNNRAYSKNK KGQVKRSIFA SPESVTGKVG VGTCGIADKP MTQYQDTSKY NVRHLMPQ 

« Hide

Isoform 2 [UniParc].

Checksum: A52A9160BD3459B8
Show »

FASTA12113,522

References

[1]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Placenta and Thymus.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
BC097986 mRNA. Translation: AAH97986.1.
BC098697 mRNA. Translation: AAH98697.1.
RefSeqNP_001020571.1. NM_001025400.3.
NP_001030311.1. NM_001035234.2.
UniGeneRn.103854.

3D structure databases

ProteinModelPortalQ4QQU6.
ModBaseSearch...
MobiDBSearch...

Proteomic databases

PaxDbQ4QQU6.
PRIDEQ4QQU6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSRNOT00000020539; ENSRNOP00000020539; ENSRNOG00000014833. [Q4QQU6-1]
GeneID287768.
KEGGrno:287768.

Organism-specific databases

CTD10285.
RGD1309151. Smndc1.

Phylogenomic databases

eggNOGNOG251685.
GeneTreeENSGT00730000111118.
HOGENOMHOG000007521.
HOVERGENHBG057021.
InParanoidQ4QQU6.
KOK12839.
OMANNKAYSK.
OrthoDBEOG7K6PVX.
PhylomeDBQ4QQU6.
TreeFamTF315413.

Gene expression databases

GenevestigatorQ4QQU6.

Family and domain databases

InterProIPR010304. Survival_motor_neuron.
IPR002999. Tudor.
[Graphical view]
PfamPF06003. SMN. 1 hit.
[Graphical view]
SMARTSM00333. TUDOR. 1 hit.
[Graphical view]
PROSITEPS50304. TUDOR. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio626977.
PROQ4QQU6.

Entry information

Entry nameSPF30_RAT
AccessionPrimary (citable) accession number: Q4QQU6
Secondary accession number(s): Q4KM88
Entry history
Integrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 19, 2005
Last modified: April 16, 2014
This is version 67 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families