Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Endothelin-converting enzyme 1

Gene

Ece1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Converts big endothelin-1 to endothelin-1.By similarity

Catalytic activityi

Hydrolysis of the 21-Trp-|-Val-22 bond in big endothelin to form endothelin 1.

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Enzyme regulationi

Inhibited by phosphoramidon.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi606Zinc; catalyticPROSITE-ProRule annotation1
Active sitei607PROSITE-ProRule annotation1
Metal bindingi610Zinc; catalyticPROSITE-ProRule annotation1
Metal bindingi666Zinc; catalyticPROSITE-ProRule annotation1
Active sitei670Proton donorPROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-MMU-375276 Peptide ligand-binding receptors

Protein family/group databases

MEROPSiM13.002

Names & Taxonomyi

Protein namesi
Recommended name:
Endothelin-converting enzyme 1 (EC:3.4.24.71)
Short name:
ECE-1
Gene namesi
Name:Ece1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1101357 Ece1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 67CytoplasmicSequence analysisAdd BLAST67
Transmembranei68 – 88Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini89 – 769ExtracellularSequence analysisAdd BLAST681

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002406291 – 769Endothelin-converting enzyme 1Add BLAST769

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei24PhosphothreonineBy similarity1
Glycosylationi165N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi186N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi209N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi246N-linked (GlcNAc...) asparagine; atypical1 Publication1
Glycosylationi250N-linked (GlcNAc...) asparagine; atypical1 Publication1
Glycosylationi269N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi315N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi361N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi382N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi383N-linked (GlcNAc...) asparagine; atypical1 Publication1
Disulfide bondi427InterchainBy similarity
Glycosylationi538N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi631N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi650N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ4PZA2
PeptideAtlasiQ4PZA2
PRIDEiQ4PZA2

PTM databases

iPTMnetiQ4PZA2
PhosphoSitePlusiQ4PZA2
SwissPalmiQ4PZA2

Expressioni

Gene expression databases

BgeeiENSMUSG00000057530
CleanExiMM_ECE1
ExpressionAtlasiQ4PZA2 baseline and differential
GenevisibleiQ4PZA2 MM

Interactioni

Subunit structurei

Homodimer; disulfide-linked (By similarity). Interacts with PPP1R16B (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000099576

Structurei

3D structure databases

ProteinModelPortaliQ4PZA2
SMRiQ4PZA2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M13 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3624 Eukaryota
COG3590 LUCA
GeneTreeiENSGT00760000119162
HOGENOMiHOG000245574
HOVERGENiHBG005554
InParanoidiQ4PZA2
KOiK01415
OMAiAPRNHDA
OrthoDBiEOG091G025Y
PhylomeDBiQ4PZA2
TreeFamiTF315192

Family and domain databases

CDDicd08662 M13, 1 hit
Gene3Di3.40.390.10, 3 hits
InterProiView protein in InterPro
IPR029733 ECE1/ECE2
IPR024079 MetalloPept_cat_dom_sf
IPR000718 Peptidase_M13
IPR018497 Peptidase_M13_C
IPR008753 Peptidase_M13_N
PANTHERiPTHR11733 PTHR11733, 1 hit
PTHR11733:SF130 PTHR11733:SF130, 1 hit
PfamiView protein in Pfam
PF01431 Peptidase_M13, 1 hit
PF05649 Peptidase_M13_N, 1 hit
PRINTSiPR00786 NEPRILYSIN
PROSITEiView protein in PROSITE
PS00142 ZINC_PROTEASE, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B (identifier: Q4PZA2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRTVWSPLAA ALAALGMSTY KRATLDEEDL VDSLSEGDVY PNGLQVNFRS
60 70 80 90 100
SRSGQRCWAA RTSVEKRLVV LVTLLAAGLV ACLAALGIQY QTRTPPVCLT
110 120 130 140 150
EACVSVTSSI LNSMDPTVDP CQDFFSYACG GWIKANPVPD GHSRWGTFSN
160 170 180 190 200
LWEHNQAVIK HLLENATASV SEAERKAQVY YRACMNETRI EELRAKPLME
210 220 230 240 250
LIEKLGGWNI TGPWAKDNFQ DTLQVVTAHY RTSPFFSVYV SADSKNSNSN
260 270 280 290 300
VIQVDQSGLG LPSRDYYLNK TENEKVLTGY LNYMVQLGKL LGGGDEDAIR
310 320 330 340 350
PQMQQILDFE TALANITIPQ EKRRDEELIY HKVTAAELQT LAPAINWLPF
360 370 380 390 400
LNTIFYPVEI NESEPIVVYD KEYLRQVSTL INNTDKCLLN NYMMWNLVRK
410 420 430 440 450
TSSFLDQRFQ DADEKFMEVM YGTKKTCIPR WKFCVSDTEN NLGFALGPMF
460 470 480 490 500
VKATFAEDSK NIASEIIMEI KKAFEESLST LKWMDEETRR SAKEKADAIY
510 520 530 540 550
NMIGYPNFIM DPKELDKVFN DYTAVPDLYF ENAMRFFNFS WRVTADQLRK
560 570 580 590 600
APNRDQWSMT PPMVNAYYSP TKNEIVFPAG ILQAPFYTRS SPNALNFGGI
610 620 630 640 650
GVVVGHELTH AFDDQGREYD KDGNLRPWWK NSSVEAFKQQ TECMVQQYSN
660 670 680 690 700
YSVNGEPVNG RHTLGENIAD NGGLKAAYRA YQNWVKKNGA EQTLPTLGLT
710 720 730 740 750
SNQLFFLGFA QVWCSVRTPE SSHEGLITDP HSPSRFRVIG SLSNSKEFSE
760
HFRCPPGSPM NPHHKCEVW
Length:769
Mass (Da):87,073
Last modified:July 19, 2005 - v1
Checksum:i58214938A0F2760A
GO
Isoform A (identifier: Q4PZA2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MRTVWSPLAAALAALGMSTYKRATLDEEDLVDSLSEGDVYPNG → MPPQSLGLQRGSFFLGKRGPGLMVSLPLLASS

Show »
Length:758
Mass (Da):85,800
Checksum:i0CC66DD2DEAE206D
GO
Isoform C (identifier: Q4PZA2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.

Show »
Length:753
Mass (Da):85,463
Checksum:iAEEF9C11ABB6657C
GO
Isoform D (identifier: Q4PZA2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: MRTVWSPLAAALAALG → METLRESVLHLALQ

Show »
Length:767
Mass (Da):87,085
Checksum:i54118EC09E36D032
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0193991 – 43MRTVW…VYPNG → MPPQSLGLQRGSFFLGKRGP GLMVSLPLLASS in isoform A. CuratedAdd BLAST43
Alternative sequenceiVSP_0194001 – 16Missing in isoform C. 2 PublicationsAdd BLAST16
Alternative sequenceiVSP_0194011 – 16MRTVW…LAALG → METLRESVLHLALQ in isoform D. CuratedAdd BLAST16

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ022741
, DQ022723, DQ022725, DQ022727, DQ022726, DQ022728, DQ022730, DQ022732, DQ022734, DQ022736, DQ022740, DQ022739, DQ022738, DQ022737, DQ022735, DQ022733, DQ022731, DQ022729 Genomic DNA Translation: AAY81993.1
DQ022741
, DQ022721, DQ022723, DQ022725, DQ022726, DQ022728, DQ022730, DQ022732, DQ022734, DQ022736, DQ022740, DQ022739, DQ022738, DQ022737, DQ022735, DQ022733, DQ022731, DQ022729, DQ022727 Genomic DNA Translation: AAY81995.1
DQ022741
, DQ022722, DQ022723, DQ022725, DQ022726, DQ022728, DQ022730, DQ022732, DQ022734, DQ022736, DQ022740, DQ022739, DQ022738, DQ022737, DQ022735, DQ022733, DQ022731, DQ022729, DQ022727 Genomic DNA Translation: AAY81996.1
DQ022741
, DQ022724, DQ022725, DQ022727, DQ022726, DQ022728, DQ022730, DQ022732, DQ022734, DQ022736, DQ022740, DQ022739, DQ022738, DQ022737, DQ022735, DQ022733, DQ022731, DQ022729 Genomic DNA Translation: AAY81997.1
AK134088 mRNA Translation: BAE22007.1
AL807764 Genomic DNA Translation: CAM23372.1
BC060648 mRNA Translation: AAH60648.1
CCDSiCCDS18822.1 [Q4PZA2-3]
RefSeqiNP_955011.1, NM_199307.2 [Q4PZA2-3]
XP_006538828.1, XM_006538765.1 [Q4PZA2-1]
XP_006538830.1, XM_006538767.3 [Q4PZA2-3]
UniGeneiMm.401062
Mm.483336

Genome annotation databases

EnsembliENSMUST00000102518; ENSMUSP00000099576; ENSMUSG00000057530 [Q4PZA2-3]
GeneIDi230857
KEGGimmu:230857
UCSCiuc008vju.2 mouse [Q4PZA2-1]
uc008vjv.1 mouse [Q4PZA2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiECE1_MOUSE
AccessioniPrimary (citable) accession number: Q4PZA2
Secondary accession number(s): B1AXF9
, Q4PZ99, Q4PZA1, Q6P9Q9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 19, 2005
Last modified: March 28, 2018
This is version 107 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health