Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Endothelin-converting enzyme 1

Gene

Ece1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Converts big endothelin-1 to endothelin-1.By similarity

Catalytic activityi

Hydrolysis of the 21-Trp-|-Val-22 bond in big endothelin to form endothelin 1.

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Enzyme regulationi

Inhibited by phosphoramidon.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi606Zinc; catalyticPROSITE-ProRule annotation1
Active sitei607PROSITE-ProRule annotation1
Metal bindingi610Zinc; catalyticPROSITE-ProRule annotation1
Metal bindingi666Zinc; catalyticPROSITE-ProRule annotation1
Active sitei670Proton donorPROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM13.002.

Names & Taxonomyi

Protein namesi
Recommended name:
Endothelin-converting enzyme 1 (EC:3.4.24.71)
Short name:
ECE-1
Gene namesi
Name:Ece1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1101357. Ece1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 67CytoplasmicSequence analysisAdd BLAST67
Transmembranei68 – 88Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini89 – 769ExtracellularSequence analysisAdd BLAST681

GO - Cellular componenti

  • cell surface Source: MGI
  • endosome Source: MGI
  • external side of plasma membrane Source: MGI
  • extracellular exosome Source: MGI
  • Golgi apparatus Source: MGI
  • integral component of membrane Source: MGI
  • lysosomal membrane Source: MGI
  • membrane Source: MGI
  • perinuclear region of cytoplasm Source: MGI
  • Weibel-Palade body Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002406291 – 769Endothelin-converting enzyme 1Add BLAST769

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei24PhosphothreonineBy similarity1
Glycosylationi165N-linked (GlcNAc...)1 Publication1
Glycosylationi186N-linked (GlcNAc...)Sequence analysis1
Glycosylationi209N-linked (GlcNAc...)1 Publication1
Glycosylationi246N-linked (GlcNAc...); atypical1 Publication1
Glycosylationi250N-linked (GlcNAc...); atypical1 Publication1
Glycosylationi269N-linked (GlcNAc...)Sequence analysis1
Glycosylationi315N-linked (GlcNAc...)1 Publication1
Glycosylationi361N-linked (GlcNAc...)2 Publications1
Glycosylationi382N-linked (GlcNAc...)1 Publication1
Glycosylationi383N-linked (GlcNAc...); atypical1 Publication1
Disulfide bondi427InterchainBy similarity
Glycosylationi538N-linked (GlcNAc...)Sequence analysis1
Glycosylationi631N-linked (GlcNAc...)Sequence analysis1
Glycosylationi650N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ4PZA2.
PeptideAtlasiQ4PZA2.
PRIDEiQ4PZA2.

PTM databases

iPTMnetiQ4PZA2.
PhosphoSitePlusiQ4PZA2.
SwissPalmiQ4PZA2.

Expressioni

Gene expression databases

BgeeiENSMUSG00000057530.
CleanExiMM_ECE1.
ExpressionAtlasiQ4PZA2. baseline and differential.
GenevisibleiQ4PZA2. MM.

Interactioni

Subunit structurei

Homodimer; disulfide-linked.By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000099576.

Structurei

3D structure databases

ProteinModelPortaliQ4PZA2.
SMRiQ4PZA2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M13 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3624. Eukaryota.
COG3590. LUCA.
GeneTreeiENSGT00760000119162.
HOGENOMiHOG000245574.
HOVERGENiHBG005554.
InParanoidiQ4PZA2.
KOiK01415.
OMAiLQVNFHS.
OrthoDBiEOG091G025Y.
PhylomeDBiQ4PZA2.
TreeFamiTF315192.

Family and domain databases

CDDicd08662. M13. 1 hit.
Gene3Di3.40.390.10. 2 hits.
InterProiIPR029734. ECE1.
IPR024079. MetalloPept_cat_dom.
IPR000718. Peptidase_M13.
IPR018497. Peptidase_M13_C.
IPR008753. Peptidase_M13_N.
[Graphical view]
PANTHERiPTHR11733. PTHR11733. 1 hit.
PTHR11733:SF130. PTHR11733:SF130. 1 hit.
PfamiPF01431. Peptidase_M13. 1 hit.
PF05649. Peptidase_M13_N. 1 hit.
[Graphical view]
PRINTSiPR00786. NEPRILYSIN.
PROSITEiPS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B (identifier: Q4PZA2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRTVWSPLAA ALAALGMSTY KRATLDEEDL VDSLSEGDVY PNGLQVNFRS
60 70 80 90 100
SRSGQRCWAA RTSVEKRLVV LVTLLAAGLV ACLAALGIQY QTRTPPVCLT
110 120 130 140 150
EACVSVTSSI LNSMDPTVDP CQDFFSYACG GWIKANPVPD GHSRWGTFSN
160 170 180 190 200
LWEHNQAVIK HLLENATASV SEAERKAQVY YRACMNETRI EELRAKPLME
210 220 230 240 250
LIEKLGGWNI TGPWAKDNFQ DTLQVVTAHY RTSPFFSVYV SADSKNSNSN
260 270 280 290 300
VIQVDQSGLG LPSRDYYLNK TENEKVLTGY LNYMVQLGKL LGGGDEDAIR
310 320 330 340 350
PQMQQILDFE TALANITIPQ EKRRDEELIY HKVTAAELQT LAPAINWLPF
360 370 380 390 400
LNTIFYPVEI NESEPIVVYD KEYLRQVSTL INNTDKCLLN NYMMWNLVRK
410 420 430 440 450
TSSFLDQRFQ DADEKFMEVM YGTKKTCIPR WKFCVSDTEN NLGFALGPMF
460 470 480 490 500
VKATFAEDSK NIASEIIMEI KKAFEESLST LKWMDEETRR SAKEKADAIY
510 520 530 540 550
NMIGYPNFIM DPKELDKVFN DYTAVPDLYF ENAMRFFNFS WRVTADQLRK
560 570 580 590 600
APNRDQWSMT PPMVNAYYSP TKNEIVFPAG ILQAPFYTRS SPNALNFGGI
610 620 630 640 650
GVVVGHELTH AFDDQGREYD KDGNLRPWWK NSSVEAFKQQ TECMVQQYSN
660 670 680 690 700
YSVNGEPVNG RHTLGENIAD NGGLKAAYRA YQNWVKKNGA EQTLPTLGLT
710 720 730 740 750
SNQLFFLGFA QVWCSVRTPE SSHEGLITDP HSPSRFRVIG SLSNSKEFSE
760
HFRCPPGSPM NPHHKCEVW
Length:769
Mass (Da):87,073
Last modified:July 19, 2005 - v1
Checksum:i58214938A0F2760A
GO
Isoform A (identifier: Q4PZA2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MRTVWSPLAAALAALGMSTYKRATLDEEDLVDSLSEGDVYPNG → MPPQSLGLQRGSFFLGKRGPGLMVSLPLLASS

Show »
Length:758
Mass (Da):85,800
Checksum:i0CC66DD2DEAE206D
GO
Isoform C (identifier: Q4PZA2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: Missing.

Show »
Length:753
Mass (Da):85,463
Checksum:iAEEF9C11ABB6657C
GO
Isoform D (identifier: Q4PZA2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-16: MRTVWSPLAAALAALG → METLRESVLHLALQ

Show »
Length:767
Mass (Da):87,085
Checksum:i54118EC09E36D032
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0193991 – 43MRTVW…VYPNG → MPPQSLGLQRGSFFLGKRGP GLMVSLPLLASS in isoform A. CuratedAdd BLAST43
Alternative sequenceiVSP_0194001 – 16Missing in isoform C. 2 PublicationsAdd BLAST16
Alternative sequenceiVSP_0194011 – 16MRTVW…LAALG → METLRESVLHLALQ in isoform D. CuratedAdd BLAST16

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ022741
, DQ022723, DQ022725, DQ022727, DQ022726, DQ022728, DQ022730, DQ022732, DQ022734, DQ022736, DQ022740, DQ022739, DQ022738, DQ022737, DQ022735, DQ022733, DQ022731, DQ022729 Genomic DNA. Translation: AAY81993.1.
DQ022741
, DQ022721, DQ022723, DQ022725, DQ022726, DQ022728, DQ022730, DQ022732, DQ022734, DQ022736, DQ022740, DQ022739, DQ022738, DQ022737, DQ022735, DQ022733, DQ022731, DQ022729, DQ022727 Genomic DNA. Translation: AAY81995.1.
DQ022741
, DQ022722, DQ022723, DQ022725, DQ022726, DQ022728, DQ022730, DQ022732, DQ022734, DQ022736, DQ022740, DQ022739, DQ022738, DQ022737, DQ022735, DQ022733, DQ022731, DQ022729, DQ022727 Genomic DNA. Translation: AAY81996.1.
DQ022741
, DQ022724, DQ022725, DQ022727, DQ022726, DQ022728, DQ022730, DQ022732, DQ022734, DQ022736, DQ022740, DQ022739, DQ022738, DQ022737, DQ022735, DQ022733, DQ022731, DQ022729 Genomic DNA. Translation: AAY81997.1.
AK134088 mRNA. Translation: BAE22007.1.
AL807764 Genomic DNA. Translation: CAM23372.1.
BC060648 mRNA. Translation: AAH60648.1.
CCDSiCCDS18822.1. [Q4PZA2-3]
RefSeqiNP_955011.1. NM_199307.2. [Q4PZA2-3]
XP_006538828.1. XM_006538765.1. [Q4PZA2-1]
XP_006538830.1. XM_006538767.3. [Q4PZA2-3]
UniGeneiMm.401062.
Mm.483336.

Genome annotation databases

EnsembliENSMUST00000102518; ENSMUSP00000099576; ENSMUSG00000057530. [Q4PZA2-3]
GeneIDi230857.
KEGGimmu:230857.
UCSCiuc008vju.2. mouse. [Q4PZA2-1]
uc008vjv.1. mouse. [Q4PZA2-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ022741
, DQ022723, DQ022725, DQ022727, DQ022726, DQ022728, DQ022730, DQ022732, DQ022734, DQ022736, DQ022740, DQ022739, DQ022738, DQ022737, DQ022735, DQ022733, DQ022731, DQ022729 Genomic DNA. Translation: AAY81993.1.
DQ022741
, DQ022721, DQ022723, DQ022725, DQ022726, DQ022728, DQ022730, DQ022732, DQ022734, DQ022736, DQ022740, DQ022739, DQ022738, DQ022737, DQ022735, DQ022733, DQ022731, DQ022729, DQ022727 Genomic DNA. Translation: AAY81995.1.
DQ022741
, DQ022722, DQ022723, DQ022725, DQ022726, DQ022728, DQ022730, DQ022732, DQ022734, DQ022736, DQ022740, DQ022739, DQ022738, DQ022737, DQ022735, DQ022733, DQ022731, DQ022729, DQ022727 Genomic DNA. Translation: AAY81996.1.
DQ022741
, DQ022724, DQ022725, DQ022727, DQ022726, DQ022728, DQ022730, DQ022732, DQ022734, DQ022736, DQ022740, DQ022739, DQ022738, DQ022737, DQ022735, DQ022733, DQ022731, DQ022729 Genomic DNA. Translation: AAY81997.1.
AK134088 mRNA. Translation: BAE22007.1.
AL807764 Genomic DNA. Translation: CAM23372.1.
BC060648 mRNA. Translation: AAH60648.1.
CCDSiCCDS18822.1. [Q4PZA2-3]
RefSeqiNP_955011.1. NM_199307.2. [Q4PZA2-3]
XP_006538828.1. XM_006538765.1. [Q4PZA2-1]
XP_006538830.1. XM_006538767.3. [Q4PZA2-3]
UniGeneiMm.401062.
Mm.483336.

3D structure databases

ProteinModelPortaliQ4PZA2.
SMRiQ4PZA2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000099576.

Protein family/group databases

MEROPSiM13.002.

PTM databases

iPTMnetiQ4PZA2.
PhosphoSitePlusiQ4PZA2.
SwissPalmiQ4PZA2.

Proteomic databases

PaxDbiQ4PZA2.
PeptideAtlasiQ4PZA2.
PRIDEiQ4PZA2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000102518; ENSMUSP00000099576; ENSMUSG00000057530. [Q4PZA2-3]
GeneIDi230857.
KEGGimmu:230857.
UCSCiuc008vju.2. mouse. [Q4PZA2-1]
uc008vjv.1. mouse. [Q4PZA2-2]

Organism-specific databases

CTDi1889.
MGIiMGI:1101357. Ece1.

Phylogenomic databases

eggNOGiKOG3624. Eukaryota.
COG3590. LUCA.
GeneTreeiENSGT00760000119162.
HOGENOMiHOG000245574.
HOVERGENiHBG005554.
InParanoidiQ4PZA2.
KOiK01415.
OMAiLQVNFHS.
OrthoDBiEOG091G025Y.
PhylomeDBiQ4PZA2.
TreeFamiTF315192.

Miscellaneous databases

ChiTaRSiEce1. mouse.
PROiQ4PZA2.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000057530.
CleanExiMM_ECE1.
ExpressionAtlasiQ4PZA2. baseline and differential.
GenevisibleiQ4PZA2. MM.

Family and domain databases

CDDicd08662. M13. 1 hit.
Gene3Di3.40.390.10. 2 hits.
InterProiIPR029734. ECE1.
IPR024079. MetalloPept_cat_dom.
IPR000718. Peptidase_M13.
IPR018497. Peptidase_M13_C.
IPR008753. Peptidase_M13_N.
[Graphical view]
PANTHERiPTHR11733. PTHR11733. 1 hit.
PTHR11733:SF130. PTHR11733:SF130. 1 hit.
PfamiPF01431. Peptidase_M13. 1 hit.
PF05649. Peptidase_M13_N. 1 hit.
[Graphical view]
PRINTSiPR00786. NEPRILYSIN.
PROSITEiPS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiECE1_MOUSE
AccessioniPrimary (citable) accession number: Q4PZA2
Secondary accession number(s): B1AXF9
, Q4PZ99, Q4PZA1, Q6P9Q9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 19, 2005
Last modified: November 2, 2016
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.