Reviewed,
UniProtKB/Swiss-Prot Q4PZA2 (ECE1_MOUSE)
Last modified
June 16, 2009.
Version 36.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Endothelin-converting enzyme 1 Short name=ECE-1 EC=3.4.24.71 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 769 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Converts big endothelin-1 to endothelin-1 By similarity. |
| Catalytic activity | Hydrolysis of the 21-Trp-|-Val-22 bond in big endothelin to form endothelin 1. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Enzyme regulation | Inhibited by phosphoramidon By similarity. |
| Subunit structure | Homodimer; disulfide-linked By similarity. |
| Subcellular location | Cell membrane; Single-pass type II membrane protein By similarity. |
| Sequence similarities | Belongs to the peptidase M13 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal-anchor Transmembrane |
| Ligand | Metal-binding Zinc |
| Molecular function | Hydrolase Metalloprotease Protease |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | pharyngeal system development Inferred from mutant phenotype. Source: MGI proteolysisInferred from electronic annotation. Source: InterPro |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | metalloendopeptidase activity Inferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform B (identifier: Q4PZA2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform A (identifier: Q4PZA2-2) The sequence of this isoform differs from the canonical sequence as follows: 1-43: MRTVWSPLAAALAALGMSTYKRATLDEEDLVDSLSEGDVYPNG → MPPQSLGLQRGSFFLGKRGPGLMVSLPLLASS | ||||||
| Isoform C (identifier: Q4PZA2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-16: Missing. | ||||||
| Isoform D (identifier: Q4PZA2-4) The sequence of this isoform differs from the canonical sequence as follows: 1-16: MRTVWSPLAAALAALG → METLRESVLHLALQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 769 | 769 | Endothelin-converting enzyme 1 | PRO_0000240629 | |||||
Regions | |||||||||
| Topological domain | 1 – 67 | 67 | Cytoplasmic Potential | ||||||
| Transmembrane | 68 – 88 | 21 | Signal-anchor for type II membrane protein Potential | ||||||
| Topological domain | 89 – 769 | 681 | Extracellular Potential | ||||||
Sites | |||||||||
| Active site | 607 | 1 | By similarity | ||||||
| Active site | 670 | 1 | Proton donor By similarity | ||||||
| Metal binding | 606 | 1 | Zinc; catalytic By similarity | ||||||
| Metal binding | 610 | 1 | Zinc; catalytic By similarity | ||||||
| Metal binding | 666 | 1 | Zinc; catalytic By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 33 | 1 | Phosphoserine By similarity | ||||||
| Glycosylation | 165 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 186 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 209 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 269 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 315 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 361 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 382 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 538 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 631 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 650 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Disulfide bond | 427 | Interchain By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 43 | 43 | MRTVW…VYPNG → MPPQSLGLQRGSFFLGKRGP GLMVSLPLLASS in isoform A. | VSP_019399 | |||||
| Alternative sequence | 1 – 16 | 16 | Missing in isoform C. | VSP_019400 | |||||
| Alternative sequence | 1 – 16 | 16 | MRTVW…LAALG → METLRESVLHLALQ in isoform D. | VSP_019401 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Genomic organisation of the mouse gene encoding endothelin-converting enzyme-1 (ECE-1) and mRNA expression of ECE-1 isoforms in murine tissues." Lindenau S., von Langsdorff C., Saxena A., Paul M., Orzechowski H.-D. Gene 373:109-115(2006) [PubMed: 16540265] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING. Strain: BALB/c. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C). Strain: C57BL/6J. Tissue: Thymus. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM C). Strain: C57BL/6. Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
DQ022741 DQ022729 Genomic DNA. Translation: AAY81993.1. DQ022741 DQ022727 Genomic DNA. Translation: AAY81995.1. DQ022741 DQ022727 Genomic DNA. Translation: AAY81996.1. DQ022741 DQ022729 Genomic DNA. Translation: AAY81997.1. AK134088 mRNA. Translation: BAE22007.1. BC060648 mRNA. Translation: AAH60648.1. | |
| IPI | IPI00396840. IPI00648026. IPI00762055. IPI00762815. |
| RefSeq | NP_955011.1. |
| UniGene | Mm.401062 Mm.439998 |
3D structure databases | |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | M13.002. |
PTM databases | |
| PhosphoSite | Q4PZA2. |
Proteomic databases | |
| PRIDE | Q4PZA2. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000057530. Mus musculus. [Contig view] |
| GeneID | 230857. |
| KEGG | mmu:230857. |
Organism-specific databases | |
| MGI | MGI:1101357. Ece1. |
Phylogenomic databases | |
| HOVERGEN | Q4PZA2. |
| OMA | Q4PZA2. MDELVAN. |
Enzyme and pathway databases | |
| BRENDA | 3.4.24.71. 244. |
Gene expression databases | |
| ArrayExpress | Q4PZA2. |
| Bgee | Q4PZA2. |
| CleanEx | MM_ECE1. |
| GermOnline | ENSMUSG00000057530. Mus musculus. |
Family and domain databases | |
| InterPro | IPR006025. Pept_M_Zn_BS. IPR000718. Peptidase_M13. IPR018497. Peptidase_M13_C. IPR008753. Peptidase_M13_N. [Graphical view] |
| PANTHER | PTHR11733. Peptidase_M13. 1 hit. |
| Pfam | PF01431. Peptidase_M13. 1 hit. PF05649. Peptidase_M13_N. 1 hit. [Graphical view] |
| PRINTS | PR00786. NEPRILYSIN. |
| PROSITE | PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 380214. |
| SOURCE | Search... |
Entry information
| Entry name | ECE1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q4PZA2 Secondary accession number(s): Q4PZ99, Q4PZA1, Q6P9Q9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


