Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1

Gene

Magi1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May play a role as scaffolding protein at cell-cell junctions. May regulate acid-induced ASIC3 currents by modulating its expression at the cell surface.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi103 – 110ATPPROSITE-ProRule annotation8

GO - Molecular functioni

Keywordsi

LigandATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
Alternative name(s):
BAI1-associated protein 1
Short name:
BAP-1
Membrane-associated guanylate kinase inverted 1
Short name:
MAGI-1
Gene namesi
Name:Magi1
Synonyms:Baiap1, Bap1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi1586025. Magi1.

Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

Cell junction, Cytoplasm, Membrane, Tight junction

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003162941 – 1255Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1Add BLAST1255

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei357PhosphoserineBy similarity1
Modified residuei729PhosphoserineBy similarity1
Modified residuei740PhosphoserineCombined sources1
Modified residuei799PhosphoserineBy similarity1
Modified residuei1070PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ4L1J4.
PRIDEiQ4L1J4.

PTM databases

iPTMnetiQ4L1J4.
PhosphoSitePlusiQ4L1J4.

Interactioni

Subunit structurei

Interacts through its WW 2 domain with SYNPO and through its PDZ 5 domain with ACTN4. Interacts with cytoplasmic domain of BAI1. Interacts via its WW domains with DRPLA (By similarity). Interacts with ESAM, LRP2 and CXADR. May interact with CTNNB1. Interacts through its PDZ 1 domain with NET1 (By similarity). Interacts with ASIC3 and AMOT. Interacts with FCHSD2 (By similarity). Interacts with IGSF5/JAM4 and through its PDZ 2 and 3 domains with NPHS1 forming a tripartite complex (PubMed:16155592). Interacts with DDN (PubMed:16751601). May interact (via PDZ domain) with RAPGEF2 (By similarity). Interacts with DLL1 (By similarity). Interacts with KCNJ10 and possibly with KCNJ10/KCNJ16 heterodimer; this interaction may facilitate KCNJ10/KCNJ16 potassium channel expression at the basolateral membrane in kidney tubular cells (By similarity).By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi271569. 3 interactors.
IntActiQ4L1J4. 6 interactors.
MINTiMINT-434022.
STRINGi10116.ENSRNOP00000065881.

Structurei

3D structure databases

ProteinModelPortaliQ4L1J4.
SMRiQ4L1J4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini17 – 105PDZ 1PROSITE-ProRule annotationAdd BLAST89
Domaini96 – 287Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST192
Domaini300 – 333WW 1PROSITE-ProRule annotationAdd BLAST34
Domaini359 – 392WW 2PROSITE-ProRule annotationAdd BLAST34
Domaini471 – 553PDZ 2PROSITE-ProRule annotationAdd BLAST83
Domaini642 – 720PDZ 3PROSITE-ProRule annotationAdd BLAST79
Domaini840 – 922PDZ 4PROSITE-ProRule annotationAdd BLAST83
Domaini997 – 1093PDZ 5PROSITE-ProRule annotationAdd BLAST97
Domaini1151 – 1233PDZ 6PROSITE-ProRule annotationAdd BLAST83

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi237 – 242Poly-Glu6
Compositional biasi399 – 420Gln-richAdd BLAST22
Compositional biasi977 – 987Poly-GlyAdd BLAST11

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3209. Eukaryota.
COG5021. LUCA.
HOVERGENiHBG007091.
InParanoidiQ4L1J4.
KOiK05631.
PhylomeDBiQ4L1J4.

Family and domain databases

CDDicd00201. WW. 2 hits.
InterProiView protein in InterPro
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR030033. MAGI1.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR001202. WW_dom.
PANTHERiPTHR10316:SF54. PTHR10316:SF54. 1 hit.
PfamiView protein in Pfam
PF00625. Guanylate_kin. 1 hit.
PF00595. PDZ. 5 hits.
PF00397. WW. 2 hits.
SMARTiView protein in SMART
SM00072. GuKc. 1 hit.
SM00228. PDZ. 6 hits.
SM00456. WW. 2 hits.
SUPFAMiSSF50156. SSF50156. 6 hits.
SSF51045. SSF51045. 2 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiView protein in PROSITE
PS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 6 hits.
PS01159. WW_DOMAIN_1. 2 hits.
PS50020. WW_DOMAIN_2. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q4L1J4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSKVIQKKNH WTGRVHECTV KRGPQGELGV TVLGGAEHGE FPYVGAVAAA
60 70 80 90 100
EAAGLPGGGE GPKLAEGELL LEVQGVRVSG LPRYDVLGVI DSCKEAVTFK
110 120 130 140 150
AVRQGGRLNK DLRHFLNQRF QKGSPDHELQ QTIRDNLYRH AVPCTTRSPR
160 170 180 190 200
EGEVPGVDYS FLTVKEFLDL EQSGTLLEVG TYEGNYYGTP KPPSQPVSGK
210 220 230 240 250
VITTDALHSL QSGSKQSTPK RTKSYNDMQN AGIVHTENEE EEDVPEMNSS
260 270 280 290 300
FTADSGDQDE PTLQEATLPP VNSSALAAPI TDPSQKFPQY LPLSAEDNLG
310 320 330 340 350
PLPENWEMAY TENGEVYFID HNAKTTSWLD PRCLNKQQKP LEECEDDEGV
360 370 380 390 400
HTEELDSELE LPAGWEKIED PVYGVYYVDH INRKTQYENP VLEAKRKRQL
410 420 430 440 450
EQQQQQQQHQ QQPQQPQPPQ PEEWTEDHAS VVPPVAPSHP PSNPEPAREA
460 470 480 490 500
PLQGKPFFTR NPSELEGKFI HTKLRKSSRG FGFTVVGGDE PDEFLQIKSL
510 520 530 540 550
VLDGPAALDG KMETGDVIVS VNDTCVLGHT HAQVVKIFQS IPIGASVDLE
560 570 580 590 600
LCRGYPLPFD PDDPNTSLVT SVAILDKEPI IVNGQETYDS PASHSSKTGK
610 620 630 640 650
VSNMKDARPS SPADVASNSS HGYPNDTVSL ASSIATQPEL ITVHIVKGPM
660 670 680 690 700
GFGFTIADSP GGGGQRVKQI VDSPRCRGLK EGDLIVEVNK RNVQALTHNQ
710 720 730 740 750
VVDMLIECPK GSEVTLLVQR GGLPVPKKSP KSQPLERKDS QNSSQHSVSS
760 770 780 790 800
LRSLHTASPS HSAQVLPEYP PADVPAPDQT DSSGQKKPDP FKIWAQSRSM
810 820 830 840 850
YEDRPMSPSP ASGLSKGERD REINSTNFGE CQIPDYQEQD IFLWRKETGF
860 870 880 890 900
GFRILGGNEP GEPIYIGHIV PLGAADTDGR LRSGDELICV DGTPVIGKSH
910 920 930 940 950
QLVVQLMQQA AKQGHVNLTV RRKVVFTVPK AENEVPSPAS SHHSSNQPAS
960 970 980 990 1000
LTEEKRTPQG SQNSLNTVSS GSGSTSGIGS GGGGGSGVVS AVLQPYDVEI
1010 1020 1030 1040 1050
RRGENEGFGF VIVSSVSRPE AGTTFAGNAC VAMPHKIGRI IEGSPADRCG
1060 1070 1080 1090 1100
KLKVGDRILA VNGCSITNKS HSDIVNLIKE AGNTVTLRII PGDESSNATL
1110 1120 1130 1140 1150
LTNAEKIATI TTTHAPSQQG TQETRTTTKP KPDSQFEFKG PQATQEQDFY
1160 1170 1180 1190 1200
TVELERGAKG FGFSLRGGRE YNMDLYVLRL AEDGPAERCG KMRIGDEILE
1210 1220 1230 1240 1250
INGETTKNMK HSRAIELIKN GGRRVRLFLR RGDGSVPEYG GSNYENIPSF

PGMTP
Length:1,255
Mass (Da):136,327
Last modified:August 2, 2005 - v1
Checksum:i1024AC37A6C44802
GO
Isoform 2 (identifier: Q4L1J4-2) [UniParc]FASTAAdd to basket
Also known as: NT-short isoform

The sequence of this isoform differs from the canonical sequence as follows:
     1-211: Missing.
     212-216: SGSKQ → MHREA
     803-833: DRPMSPSPASGLSKGERDREINSTNFGECQI → NRL

Show »
Length:1,016
Mass (Da):110,614
Checksum:i649E89E21B56F3D5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti323A → T in AAT99088 (Ref. 1) Curated1
Sequence conflicti466E → K in AAT99088 (Ref. 1) Curated1
Sequence conflicti648G → E in AAT99088 (Ref. 1) Curated1
Sequence conflicti780T → A in AAT99088 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0307621 – 211Missing in isoform 2. 1 PublicationAdd BLAST211
Alternative sequenceiVSP_030763212 – 216SGSKQ → MHREA in isoform 2. 1 Publication5
Alternative sequenceiVSP_030764803 – 833DRPMS…GECQI → NRL in isoform 2. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY598951 mRNA. Translation: AAT99088.1.
AY598952 mRNA. Translation: AAT99089.1.
RefSeqiNP_001025216.1. NM_001030045.1. [Q4L1J4-1]
UniGeneiRn.95239.

Genome annotation databases

GeneIDi500261.
KEGGirno:500261.
UCSCiRGD:1586025. rat. [Q4L1J4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMAGI1_RAT
AccessioniPrimary (citable) accession number: Q4L1J4
Secondary accession number(s): Q4L1J5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: August 2, 2005
Last modified: August 30, 2017
This is version 75 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome