Reviewed,
UniProtKB/Swiss-Prot Q4KWH8 (PLCH1_HUMAN)
Last modified
February 9, 2010.
Version 49.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase eta-1 EC=3.1.4.11 Alternative name(s): Phosphoinositide phospholipase C-eta-1 Phospholipase C-eta-1 Short name=PLC-eta-1 Phospholipase C-like protein 3 Short name=PLC-L3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1693 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by calcium-activated phosphatidylinositol-specific phospholipase C enzymes. Ref.1 |
| Catalytic activity | 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol. |
| Cofactor | Calcium. |
| Subcellular location | |
| Tissue specificity | Expressed in brain and to a lower extent in lung. In brain, it is found in cerebrum, cerebellum and spinal cord. Ref.1 |
| Sequence similarities | Contains 1 C2 domain. Contains 2 EF-hand domains. Contains 1 PH domain. Contains 1 PI-PLC X-box domain. Contains 1 PI-PLC Y-box domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid degradation |
| Cellular component | Cytoplasm Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Ligand | Calcium Metal-binding |
| Molecular function | Hydrolase Transducer |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | lipid catabolic process Inferred from electronic annotation. Source: UniProtKB-KW phosphoinositide-mediated signaling Ref.1Inferred from direct assay. Source: MGI |
| Cellular component | membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: UniProtKB-KW calcium-dependent phospholipase C activity Ref.1Inferred from direct assay. Source: MGI phosphoinositide phospholipase C activityInferred from electronic annotation. Source: EC signal transducer activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q4KWH8-1) Also known as: PLC-eta-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q4KWH8-2) The sequence of this isoform differs from the canonical sequence as follows: 1-18: Missing. 862-881: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q4KWH8-3) Also known as: PLC-eta-1a; The sequence of this isoform differs from the canonical sequence as follows: 1000-1002: AED → VQI 1003-1693: Missing. | ||||||
| Isoform 4 (identifier: Q4KWH8-4) The sequence of this isoform differs from the canonical sequence as follows: 862-881: Missing. 1000-1034: AEDKDGRRKGKASIKDPHFLNFNKKLSSSSSALLH → DSSFCRPTEQAKAEMCKVPFPRQLECVMKMEISET 1035-1693: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1693 | 1693 | 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase eta-1 | PRO_0000329007 | |||||
Regions | |||||||||
| Domain | 20 – 128 | 109 | PH | ||||||
| Domain | 142 – 177 | 36 | EF-hand 1 | ||||||
| Domain | 178 – 214 | 37 | EF-hand 2 | ||||||
| Domain | 299 – 444 | 146 | PI-PLC X-box | ||||||
| Domain | 601 – 714 | 114 | PI-PLC Y-box | ||||||
| Domain | 719 – 826 | 108 | C2 | ||||||
| Calcium binding | 155 – 166 | 12 | Potential | ||||||
| Compositional bias | 1026 – 1030 | 5 | Poly-Ser | ||||||
Sites | |||||||||
| Active site | 314 | 1 | By similarity | ||||||
| Active site | 358 | 1 | By similarity | ||||||
| Metal binding | 315 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 344 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 346 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 393 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 758 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 760 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 784 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 813 | 1 | Calcium 3 By similarity | ||||||
| Metal binding | 814 | 1 | Calcium 3; via carbonyl oxygen By similarity | ||||||
| Metal binding | 815 | 1 | Calcium 3 By similarity | ||||||
| Binding site | 442 | 1 | Substrate By similarity | ||||||
| Binding site | 444 | 1 | Substrate By similarity | ||||||
| Binding site | 627 | 1 | Substrate By similarity | ||||||
| Binding site | 654 | 1 | Substrate By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1307 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 1494 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 18 | 18 | Missing in isoform 2. | VSP_032901 | |||||
| Alternative sequence | 862 – 881 | 20 | Missing in isoform 2 and isoform 4. | VSP_032902 | |||||
| Alternative sequence | 1000 – 1034 | 35 | AEDKD…SALLH → DSSFCRPTEQAKAEMCKVPF PRQLECVMKMEISET in isoform 4. | VSP_032903 | |||||
| Alternative sequence | 1000 – 1002 | 3 | AED → VQI in isoform 3. | VSP_032904 | |||||
| Alternative sequence | 1003 – 1693 | 691 | Missing in isoform 3. | VSP_032905 | |||||
| Alternative sequence | 1035 – 1693 | 659 | Missing in isoform 4. | VSP_032906 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Molecular cloning and characterization of a novel phospholipase C, PLC-eta." Hwang J.-I., Oh Y.-S., Shin K.-J., Kim H., Ryu S.H., Suh P.-G. Biochem. J. 389:181-186(2005) [PubMed: 15702972] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 926-1693 (ISOFORM 1). Tissue: Eye and Testis. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 6:197-205(1999) [PubMed: 10470851] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 216-1693 (ISOFORM 3). Tissue: Brain. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 392-1034 (ISOFORM 4). |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1470-1693 (ISOFORMS 1/2). Tissue: Testis. |
| [6] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1307 AND SER-1494, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY691170 mRNA. Translation: AAW22607.1. AY691171 mRNA. Translation: AAW22608.1. BC043248 mRNA. Translation: AAH43248.2. BC113950 mRNA. Translation: AAI13951.1. AB028992 mRNA. Translation: BAA83021.1. AK022610 mRNA. Translation: BAB14129.1. Different initiation. CR749869 mRNA. Translation: CAH18710.1. |
| IPI | IPI00175416. IPI00783616. IPI00848061. IPI00889624. |
| RefSeq | NP_001124432.1. NP_001124433.1. NP_055811.1. |
| UniGene | Hs.567423 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1QAS based on UniProtKB P10688. |
| SMR | Q4KWH8. Positions 19-857. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q4KWH8. |
PTM databases | |
| PhosphoSite | Q4KWH8. |
Proteomic databases | |
| PRIDE | Q4KWH8. |
Genome annotation databases | |
| Ensembl | ENST00000340059; ENSP00000345988; ENSG00000114805; Homo sapiens. [Genome view] |
| GeneID | 23007. |
| KEGG | hsa:23007. |
| UCSC | uc003fai.2. human. uc003faj.2. human. uc010hvs.1. human. |
Organism-specific databases | |
| CTD | 23007. |
| GeneCards | GC03M156577. |
| HGNC | HGNC:29185. PLCH1. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG12321. |
| HOVERGEN | Q4KWH8. |
| InParanoid | Q4KWH8. |
| OMA | LRNGYCK. |
| PhylomeDB | Q4KWH8. |
Enzyme and pathway databases | |
| BRENDA | 3.1.4.11. 247. |
Gene expression databases | |
| ArrayExpress | Q4KWH8. |
| Bgee | Q4KWH8. |
| CleanEx | HS_PLCH1. |
| Genevestigator | Q4KWH8. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR018249. EF_HAND_2. IPR002048. EF_hand_Ca_bd. IPR011993. PH_type. IPR015359. Phospholipase_C_EF-hand-like. IPR001192. Phospholipase_C_Pinositol-sp_C. IPR001711. Phospholipase_C_Pinositol-sp_Y. IPR017946. PLC-like_Pdiesterase_TIM-brl. IPR001849. Pleckstrin_homology. IPR000909. PLipase_C_PInositol-sp_X_dom. [Graphical view] |
| Gene3D | G3DSA:1.10.238.10. EF-Hand_type. 2 hits. G3DSA:2.30.29.30. PH_type. 1 hit. G3DSA:3.20.20.190. PLC-like_Pdiesterase_TIM-brl. 1 hit. |
| Pfam | PF00168. C2. 1 hit. PF09279. efhand_like. 1 hit. PF00388. PI-PLC-X. 1 hit. PF00387. PI-PLC-Y. 1 hit. [Graphical view] |
| PRINTS | PR00390. PHPHLIPASEC. |
| SMART | SM00239. C2. 1 hit. SM00054. EFh. 2 hits. SM00233. PH. 1 hit. SM00148. PLCXc. 1 hit. SM00149. PLCYc. 1 hit. [Graphical view] |
| PROSITE | PS50004. C2. 1 hit. PS00018. EF_HAND_1. 1 hit. PS50222. EF_HAND_2. 3 hits. PS50003. PH_DOMAIN. 1 hit. PS50007. PIPLC_X_DOMAIN. 1 hit. PS50008. PIPLC_Y_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 43921. |
Entry information
| Entry name | PLCH1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q4KWH8 Secondary accession number(s): Q29RV9 Q9UPT3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with


