Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q4KWH8

- PLCH1_HUMAN

UniProt

Q4KWH8 - PLCH1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1

Gene

PLCH1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by calcium-activated phosphatidylinositol-specific phospholipase C enzymes.1 Publication

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Calcium.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei314 – 3141PROSITE-ProRule annotation
Metal bindingi315 – 3151Calcium 1; catalyticBy similarity
Metal bindingi344 – 3441Calcium 1; catalyticBy similarity
Metal bindingi346 – 3461Calcium 1; catalyticBy similarity
Active sitei358 – 3581PROSITE-ProRule annotation
Metal bindingi393 – 3931Calcium 1; catalyticBy similarity
Binding sitei442 – 4421SubstrateBy similarity
Binding sitei444 – 4441SubstrateBy similarity
Binding sitei627 – 6271SubstrateBy similarity
Binding sitei654 – 6541SubstrateBy similarity
Metal bindingi758 – 7581Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi760 – 7601Calcium 2By similarity
Metal bindingi784 – 7841Calcium 2By similarity
Metal bindingi813 – 8131Calcium 3By similarity
Metal bindingi814 – 8141Calcium 3; via carbonyl oxygenBy similarity
Metal bindingi815 – 8151Calcium 3By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi155 – 16612PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. calcium-dependent phospholipase C activity Source: MGI
  2. calcium ion binding Source: InterPro
  3. phosphatidylinositol phospholipase C activity Source: UniProtKB-EC
  4. signal transducer activity Source: UniProtKB-KW

GO - Biological processi

  1. inositol phosphate metabolic process Source: Reactome
  2. lipid catabolic process Source: UniProtKB-KW
  3. phosphatidylinositol-mediated signaling Source: MGI
  4. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Transducer

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

BRENDAi3.1.4.11. 2681.
ReactomeiREACT_150312. Synthesis of IP3 and IP4 in the cytosol.

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-eta-1
Phospholipase C-eta-1
Short name:
PLC-eta-1
Phospholipase C-like protein 3
Short name:
PLC-L3
Gene namesi
Name:PLCH1
Synonyms:KIAA1069, PLCL3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:29185. PLCH1.

Subcellular locationi

Cytoplasm 1 Publication. Membrane 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: MGI
  2. cytosol Source: Ensembl
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA128394595.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 169316931-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1PRO_0000329007Add
BLAST

Proteomic databases

MaxQBiQ4KWH8.
PaxDbiQ4KWH8.
PRIDEiQ4KWH8.

PTM databases

PhosphoSiteiQ4KWH8.

Expressioni

Tissue specificityi

Expressed in brain and to a lower extent in lung. In brain, it is found in cerebrum, cerebellum and spinal cord.1 Publication

Gene expression databases

BgeeiQ4KWH8.
CleanExiHS_PLCH1.
GenevestigatoriQ4KWH8.

Organism-specific databases

HPAiHPA036176.

Interactioni

Protein-protein interaction databases

BioGridi116651. 1 interaction.
IntActiQ4KWH8. 1 interaction.
STRINGi9606.ENSP00000345988.

Structurei

3D structure databases

ProteinModelPortaliQ4KWH8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini20 – 128109PHPROSITE-ProRule annotationAdd
BLAST
Domaini142 – 17736EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini178 – 21437EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini299 – 444146PI-PLC X-boxPROSITE-ProRule annotationAdd
BLAST
Domaini601 – 714114PI-PLC Y-boxPROSITE-ProRule annotationAdd
BLAST
Domaini719 – 826108C2PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1026 – 10305Poly-Ser

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 2 EF-hand domains.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG149692.
GeneTreeiENSGT00760000118936.
HOVERGENiHBG095591.
InParanoidiQ4KWH8.
OMAiIEDECKF.
OrthoDBiEOG7PGDQ0.
PhylomeDBiQ4KWH8.
TreeFamiTF313216.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR028392. PLC-eta1.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF51. PTHR10336:SF51. 1 hit.
PfamiPF00168. C2. 1 hit.
PF13499. EF-hand_7. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view]
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00054. EFh. 2 hits.
SM00233. PH. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEiPS50004. C2. 1 hit.
PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 3 hits.
PS50003. PH_DOMAIN. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q4KWH8-1) [UniParc]FASTAAdd to Basket

Also known as: PLC-eta-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MADLEVYKNL SPEKVERCMS VMQSGTQMIK LKRGTKGLVR LFYLDEHRTR
60 70 80 90 100
LRWRPSRKSE KAKILIDSIY KVTEGRQSEI FHRQAEGNFD PSCCFTIYHG
110 120 130 140 150
NHMESLDLIT SNPEEARTWI TGLKYLMAGI SDEDSLAKRQ RTHDQWVKQT
160 170 180 190 200
FEEADKNGDG LLNIEEIHQL MHKLNVNLPR RKVRQMFQEA DTDENQGTLT
210 220 230 240 250
FEEFCVFYKM MSLRRDLYLL LLSYSDKKDH LTVEELAQFL KVEQKMNNVT
260 270 280 290 300
TDYCLDIIKK FEVSEENKVK NVLGIEGFTN FMRSPACDIF NPLHHEVYQD
310 320 330 340 350
MDQPLCNYYI ASSHNTYLTG DQLLSQSKVD MYARVLQEGC RCVEVDCWDG
360 370 380 390 400
PDGEPVVHHG YTLTSKILFR DVVETINKHA FVKNEFPVIL SIENHCSIQQ
410 420 430 440 450
QRKIAQYLKG IFGDKLDLSS VDTGECKQLP SPQSLKGKIL VKGKKLPYHL
460 470 480 490 500
GDDAEEGEVS DEDSADEIED ECKFKLHYSN GTTEHQVESF IRKKLESLLK
510 520 530 540 550
ESQIRDKEDP DSFTVRALLK ATHEGLNAHL KQSPDVKESG KKSHGRSLMT
560 570 580 590 600
NFGKHKKTTK SRSKSYSTDD EEDTQQSTGK EGGQLYRLGR RRKTMKLCRE
610 620 630 640 650
LSDLVVYTNS VAAQDIVDDG TTGNVLSFSE TRAHQVVQQK SEQFMIYNQK
660 670 680 690 700
QLTRIYPSAY RIDSSNFNPL PYWNAGCQLV ALNYQSEGRM MQLNRAKFKA
710 720 730 740 750
NGNCGYVLKP QQMCKGTFNP FSGDPLPANP KKQLILKVIS GQQLPKPPDS
760 770 780 790 800
MFGDRGEIID PFVEVEIIGL PVDCCKDQTR VVDDNGFNPV WEETLTFTVH
810 820 830 840 850
MPEIALVRFL VWDHDPIGRD FVGQRTVTFS SLVPGYRHVY LEGLTEASIF
860 870 880 890 900
VHITINEIYG KWSPLILNPS YTILHFLGAT KNRQLQGLKG LFNKNPRHSS
910 920 930 940 950
SENNSHYVRK RSIGDRILRR TASAPAKGRK KSKMGFQEMV EIKDSVSEAT
960 970 980 990 1000
RDQDGVLRRT TRSLQARPVS MPVDRNLLGA LSLPVSETAK DIEGKENSLA
1010 1020 1030 1040 1050
EDKDGRRKGK ASIKDPHFLN FNKKLSSSSS ALLHKDTSQG DTIVSTAHMS
1060 1070 1080 1090 1100
VTGEQLGMSS PRGGRTTSNA TSNCQENPCP SKSLSPKQHL APDPVVNPTQ
1110 1120 1130 1140 1150
DLHGVKIKEK GNPEDFVEGK SILSGSVLSH SNLEIKNLEG NRGKGRAATS
1160 1170 1180 1190 1200
FSLSDVSMLC SDIPDLHSTA ILQESVISHL IDNVTLTNEN EPGSSISALI
1210 1220 1230 1240 1250
GQFDETNNQA LTVVSHLHNT SVMSGHCPLP SLGLKMPIKH GFCKGKSKSS
1260 1270 1280 1290 1300
FLCSSPELIA LSSSETTKHA TNTVYETTCT PISKTKPDDD LSSKAKTAAL
1310 1320 1330 1340 1350
ESNLPGSPNT SRGWLPKSPT KGEDWETLKS CSPASSPDLT LEDVIADPTL
1360 1370 1380 1390 1400
CFNSGESSLV EIDGESENLS LTTCEYRREG TSQLASPLKL KYNQGVVEHF
1410 1420 1430 1440 1450
QRGLRNGYCK ETLRPSVPEI FNNIQDVKTQ SISYLAYQGA GFVHNHFSDS
1460 1470 1480 1490 1500
DAKMFQTCVP QQSSAQDMHV PVPKQLAHLP LPALKLPSPC KSKSLGDLTS
1510 1520 1530 1540 1550
EDIACNFESK YQCISKSFVT TGIRDKKGVT VKTKSLEPID ALTEQLRKLV
1560 1570 1580 1590 1600
SFDQEDNCQV LYSKQDANQL PRALVRKLSS RSQSRVRNIA SRAKEKQEAN
1610 1620 1630 1640 1650
KQKVPNPSNG AGVVLRNKPS APTPAVNRHS TGSYIAGYLK NTKGGGLEGR
1660 1670 1680 1690
GIPEGACTAL HYGHVDQFCS DNSVLQTEPS SDDKPEIYFL LRL
Length:1,693
Mass (Da):189,223
Last modified:August 2, 2005 - v1
Checksum:i00F2ADD21C4D14E6
GO
Isoform 2 (identifier: Q4KWH8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: Missing.
     862-881: Missing.

Note: No experimental confirmation available.

Show »
Length:1,655
Mass (Da):184,863
Checksum:i42135E91A9064CEF
GO
Isoform 3 (identifier: Q4KWH8-3) [UniParc]FASTAAdd to Basket

Also known as: PLC-eta-1a

The sequence of this isoform differs from the canonical sequence as follows:
     1000-1002: AED → VQI
     1003-1693: Missing.

Show »
Length:1,002
Mass (Da):114,506
Checksum:i333C3E46F453A55D
GO
Isoform 4 (identifier: Q4KWH8-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     862-881: Missing.
     1000-1034: AEDKDGRRKGKASIKDPHFLNFNKKLSSSSSALLH → DSSFCRPTEQAKAEMCKVPFPRQLECVMKMEISET
     1035-1693: Missing.

Note: No experimental confirmation available.

Show »
Length:1,014
Mass (Da):115,945
Checksum:i74AA8EB84E16050F
GO

Sequence cautioni

The sequence BAB14129.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1818Missing in isoform 2. 1 PublicationVSP_032901Add
BLAST
Alternative sequencei862 – 88120Missing in isoform 2 and isoform 4. 2 PublicationsVSP_032902Add
BLAST
Alternative sequencei1000 – 103435AEDKD…SALLH → DSSFCRPTEQAKAEMCKVPF PRQLECVMKMEISET in isoform 4. 1 PublicationVSP_032903Add
BLAST
Alternative sequencei1000 – 10023AED → VQI in isoform 3. 2 PublicationsVSP_032904
Alternative sequencei1003 – 1693691Missing in isoform 3. 2 PublicationsVSP_032905Add
BLAST
Alternative sequencei1035 – 1693659Missing in isoform 4. 1 PublicationVSP_032906Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY691170 mRNA. Translation: AAW22607.1.
AY691171 mRNA. Translation: AAW22608.1.
BC043248 mRNA. Translation: AAH43248.2.
BC113950 mRNA. Translation: AAI13951.1.
AB028992 mRNA. Translation: BAA83021.1.
AK022610 mRNA. Translation: BAB14129.1. Different initiation.
CR749869 mRNA. Translation: CAH18710.1.
CCDSiCCDS33881.1. [Q4KWH8-2]
CCDS46939.1. [Q4KWH8-1]
CCDS46940.1. [Q4KWH8-3]
RefSeqiNP_001124432.1. NM_001130960.1. [Q4KWH8-1]
NP_001124433.1. NM_001130961.1. [Q4KWH8-3]
NP_055811.1. NM_014996.2. [Q4KWH8-2]
UniGeneiHs.567423.

Genome annotation databases

EnsembliENST00000334686; ENSP00000335469; ENSG00000114805. [Q4KWH8-2]
ENST00000340059; ENSP00000345988; ENSG00000114805. [Q4KWH8-1]
ENST00000447496; ENSP00000402759; ENSG00000114805. [Q4KWH8-3]
ENST00000460012; ENSP00000417502; ENSG00000114805. [Q4KWH8-2]
ENST00000494598; ENSP00000419100; ENSG00000114805. [Q4KWH8-4]
GeneIDi23007.
KEGGihsa:23007.
UCSCiuc021xgd.1. human. [Q4KWH8-3]
uc021xge.1. human. [Q4KWH8-1]
uc021xgf.1. human. [Q4KWH8-2]

Polymorphism databases

DMDMi121947010.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY691170 mRNA. Translation: AAW22607.1 .
AY691171 mRNA. Translation: AAW22608.1 .
BC043248 mRNA. Translation: AAH43248.2 .
BC113950 mRNA. Translation: AAI13951.1 .
AB028992 mRNA. Translation: BAA83021.1 .
AK022610 mRNA. Translation: BAB14129.1 . Different initiation.
CR749869 mRNA. Translation: CAH18710.1 .
CCDSi CCDS33881.1. [Q4KWH8-2 ]
CCDS46939.1. [Q4KWH8-1 ]
CCDS46940.1. [Q4KWH8-3 ]
RefSeqi NP_001124432.1. NM_001130960.1. [Q4KWH8-1 ]
NP_001124433.1. NM_001130961.1. [Q4KWH8-3 ]
NP_055811.1. NM_014996.2. [Q4KWH8-2 ]
UniGenei Hs.567423.

3D structure databases

ProteinModelPortali Q4KWH8.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116651. 1 interaction.
IntActi Q4KWH8. 1 interaction.
STRINGi 9606.ENSP00000345988.

PTM databases

PhosphoSitei Q4KWH8.

Polymorphism databases

DMDMi 121947010.

Proteomic databases

MaxQBi Q4KWH8.
PaxDbi Q4KWH8.
PRIDEi Q4KWH8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000334686 ; ENSP00000335469 ; ENSG00000114805 . [Q4KWH8-2 ]
ENST00000340059 ; ENSP00000345988 ; ENSG00000114805 . [Q4KWH8-1 ]
ENST00000447496 ; ENSP00000402759 ; ENSG00000114805 . [Q4KWH8-3 ]
ENST00000460012 ; ENSP00000417502 ; ENSG00000114805 . [Q4KWH8-2 ]
ENST00000494598 ; ENSP00000419100 ; ENSG00000114805 . [Q4KWH8-4 ]
GeneIDi 23007.
KEGGi hsa:23007.
UCSCi uc021xgd.1. human. [Q4KWH8-3 ]
uc021xge.1. human. [Q4KWH8-1 ]
uc021xgf.1. human. [Q4KWH8-2 ]

Organism-specific databases

CTDi 23007.
GeneCardsi GC03M155094.
H-InvDB HIX0119148.
HGNCi HGNC:29185. PLCH1.
HPAi HPA036176.
MIMi 612835. gene.
neXtProti NX_Q4KWH8.
PharmGKBi PA128394595.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG149692.
GeneTreei ENSGT00760000118936.
HOVERGENi HBG095591.
InParanoidi Q4KWH8.
OMAi IEDECKF.
OrthoDBi EOG7PGDQ0.
PhylomeDBi Q4KWH8.
TreeFami TF313216.

Enzyme and pathway databases

BRENDAi 3.1.4.11. 2681.
Reactomei REACT_150312. Synthesis of IP3 and IP4 in the cytosol.

Miscellaneous databases

GenomeRNAii 23007.
NextBioi 43921.
PROi Q4KWH8.
SOURCEi Search...

Gene expression databases

Bgeei Q4KWH8.
CleanExi HS_PLCH1.
Genevestigatori Q4KWH8.

Family and domain databases

Gene3Di 1.10.238.10. 2 hits.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProi IPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR028392. PLC-eta1.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view ]
PANTHERi PTHR10336. PTHR10336. 1 hit.
PTHR10336:SF51. PTHR10336:SF51. 1 hit.
Pfami PF00168. C2. 1 hit.
PF13499. EF-hand_7. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view ]
PRINTSi PR00390. PHPHLIPASEC.
SMARTi SM00239. C2. 1 hit.
SM00054. EFh. 2 hits.
SM00233. PH. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEi PS50004. C2. 1 hit.
PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 3 hits.
PS50003. PH_DOMAIN. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of a novel phospholipase C, PLC-eta."
    Hwang J.-I., Oh Y.-S., Shin K.-J., Kim H., Ryu S.H., Suh P.-G.
    Biochem. J. 389:181-186(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 926-1693 (ISOFORM 1).
    Tissue: Eye and Testis.
  3. "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 216-1693 (ISOFORM 3).
    Tissue: Brain.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 392-1034 (ISOFORM 4).
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1470-1693 (ISOFORMS 1/2).
    Tissue: Testis.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPLCH1_HUMAN
AccessioniPrimary (citable) accession number: Q4KWH8
Secondary accession number(s): Q29RV9
, Q4KWH9, Q68CN0, Q86XK4, Q9H9U2, Q9UPT3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: August 2, 2005
Last modified: October 29, 2014
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3