Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q4KWH8 (PLCH1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 95. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1

EC=3.1.4.11
Alternative name(s):
Phosphoinositide phospholipase C-eta-1
Phospholipase C-eta-1
Short name=PLC-eta-1
Phospholipase C-like protein 3
Short name=PLC-L3
Gene names
Name:PLCH1
Synonyms:KIAA1069, PLCL3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1693 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by calcium-activated phosphatidylinositol-specific phospholipase C enzymes. Ref.1

Catalytic activity

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactor

Calcium.

Subcellular location

Cytoplasm. Membrane Ref.1.

Tissue specificity

Expressed in brain and to a lower extent in lung. In brain, it is found in cerebrum, cerebellum and spinal cord. Ref.1

Sequence similarities

Contains 1 C2 domain.

Contains 2 EF-hand domains.

Contains 1 PH domain.

Contains 1 PI-PLC X-box domain.

Contains 1 PI-PLC Y-box domain.

Sequence caution

The sequence BAB14129.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q4KWH8-1)

Also known as: PLC-eta-1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q4KWH8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: Missing.
     862-881: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q4KWH8-3)

Also known as: PLC-eta-1a;

The sequence of this isoform differs from the canonical sequence as follows:
     1000-1002: AED → VQI
     1003-1693: Missing.
Isoform 4 (identifier: Q4KWH8-4)

The sequence of this isoform differs from the canonical sequence as follows:
     862-881: Missing.
     1000-1034: AEDKDGRRKGKASIKDPHFLNFNKKLSSSSSALLH → DSSFCRPTEQAKAEMCKVPFPRQLECVMKMEISET
     1035-1693: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 169316931-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1
PRO_0000329007

Regions

Domain20 – 128109PH
Domain142 – 17736EF-hand 1
Domain178 – 21437EF-hand 2
Domain299 – 444146PI-PLC X-box
Domain601 – 714114PI-PLC Y-box
Domain719 – 826108C2
Calcium binding155 – 16612 Potential
Compositional bias1026 – 10305Poly-Ser

Sites

Active site3141 By similarity
Active site3581 By similarity
Metal binding3151Calcium 1; catalytic By similarity
Metal binding3441Calcium 1; catalytic By similarity
Metal binding3461Calcium 1; catalytic By similarity
Metal binding3931Calcium 1; catalytic By similarity
Metal binding7581Calcium 2; via carbonyl oxygen By similarity
Metal binding7601Calcium 2 By similarity
Metal binding7841Calcium 2 By similarity
Metal binding8131Calcium 3 By similarity
Metal binding8141Calcium 3; via carbonyl oxygen By similarity
Metal binding8151Calcium 3 By similarity
Binding site4421Substrate By similarity
Binding site4441Substrate By similarity
Binding site6271Substrate By similarity
Binding site6541Substrate By similarity

Natural variations

Alternative sequence1 – 1818Missing in isoform 2.
VSP_032901
Alternative sequence862 – 88120Missing in isoform 2 and isoform 4.
VSP_032902
Alternative sequence1000 – 103435AEDKD…SALLH → DSSFCRPTEQAKAEMCKVPF PRQLECVMKMEISET in isoform 4.
VSP_032903
Alternative sequence1000 – 10023AED → VQI in isoform 3.
VSP_032904
Alternative sequence1003 – 1693691Missing in isoform 3.
VSP_032905
Alternative sequence1035 – 1693659Missing in isoform 4.
VSP_032906

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (PLC-eta-1) [UniParc].

Last modified August 2, 2005. Version 1.
Checksum: 00F2ADD21C4D14E6

FASTA1,693189,223
        10         20         30         40         50         60 
MADLEVYKNL SPEKVERCMS VMQSGTQMIK LKRGTKGLVR LFYLDEHRTR LRWRPSRKSE 

        70         80         90        100        110        120 
KAKILIDSIY KVTEGRQSEI FHRQAEGNFD PSCCFTIYHG NHMESLDLIT SNPEEARTWI 

       130        140        150        160        170        180 
TGLKYLMAGI SDEDSLAKRQ RTHDQWVKQT FEEADKNGDG LLNIEEIHQL MHKLNVNLPR 

       190        200        210        220        230        240 
RKVRQMFQEA DTDENQGTLT FEEFCVFYKM MSLRRDLYLL LLSYSDKKDH LTVEELAQFL 

       250        260        270        280        290        300 
KVEQKMNNVT TDYCLDIIKK FEVSEENKVK NVLGIEGFTN FMRSPACDIF NPLHHEVYQD 

       310        320        330        340        350        360 
MDQPLCNYYI ASSHNTYLTG DQLLSQSKVD MYARVLQEGC RCVEVDCWDG PDGEPVVHHG 

       370        380        390        400        410        420 
YTLTSKILFR DVVETINKHA FVKNEFPVIL SIENHCSIQQ QRKIAQYLKG IFGDKLDLSS 

       430        440        450        460        470        480 
VDTGECKQLP SPQSLKGKIL VKGKKLPYHL GDDAEEGEVS DEDSADEIED ECKFKLHYSN 

       490        500        510        520        530        540 
GTTEHQVESF IRKKLESLLK ESQIRDKEDP DSFTVRALLK ATHEGLNAHL KQSPDVKESG 

       550        560        570        580        590        600 
KKSHGRSLMT NFGKHKKTTK SRSKSYSTDD EEDTQQSTGK EGGQLYRLGR RRKTMKLCRE 

       610        620        630        640        650        660 
LSDLVVYTNS VAAQDIVDDG TTGNVLSFSE TRAHQVVQQK SEQFMIYNQK QLTRIYPSAY 

       670        680        690        700        710        720 
RIDSSNFNPL PYWNAGCQLV ALNYQSEGRM MQLNRAKFKA NGNCGYVLKP QQMCKGTFNP 

       730        740        750        760        770        780 
FSGDPLPANP KKQLILKVIS GQQLPKPPDS MFGDRGEIID PFVEVEIIGL PVDCCKDQTR 

       790        800        810        820        830        840 
VVDDNGFNPV WEETLTFTVH MPEIALVRFL VWDHDPIGRD FVGQRTVTFS SLVPGYRHVY 

       850        860        870        880        890        900 
LEGLTEASIF VHITINEIYG KWSPLILNPS YTILHFLGAT KNRQLQGLKG LFNKNPRHSS 

       910        920        930        940        950        960 
SENNSHYVRK RSIGDRILRR TASAPAKGRK KSKMGFQEMV EIKDSVSEAT RDQDGVLRRT 

       970        980        990       1000       1010       1020 
TRSLQARPVS MPVDRNLLGA LSLPVSETAK DIEGKENSLA EDKDGRRKGK ASIKDPHFLN 

      1030       1040       1050       1060       1070       1080 
FNKKLSSSSS ALLHKDTSQG DTIVSTAHMS VTGEQLGMSS PRGGRTTSNA TSNCQENPCP 

      1090       1100       1110       1120       1130       1140 
SKSLSPKQHL APDPVVNPTQ DLHGVKIKEK GNPEDFVEGK SILSGSVLSH SNLEIKNLEG 

      1150       1160       1170       1180       1190       1200 
NRGKGRAATS FSLSDVSMLC SDIPDLHSTA ILQESVISHL IDNVTLTNEN EPGSSISALI 

      1210       1220       1230       1240       1250       1260 
GQFDETNNQA LTVVSHLHNT SVMSGHCPLP SLGLKMPIKH GFCKGKSKSS FLCSSPELIA 

      1270       1280       1290       1300       1310       1320 
LSSSETTKHA TNTVYETTCT PISKTKPDDD LSSKAKTAAL ESNLPGSPNT SRGWLPKSPT 

      1330       1340       1350       1360       1370       1380 
KGEDWETLKS CSPASSPDLT LEDVIADPTL CFNSGESSLV EIDGESENLS LTTCEYRREG 

      1390       1400       1410       1420       1430       1440 
TSQLASPLKL KYNQGVVEHF QRGLRNGYCK ETLRPSVPEI FNNIQDVKTQ SISYLAYQGA 

      1450       1460       1470       1480       1490       1500 
GFVHNHFSDS DAKMFQTCVP QQSSAQDMHV PVPKQLAHLP LPALKLPSPC KSKSLGDLTS 

      1510       1520       1530       1540       1550       1560 
EDIACNFESK YQCISKSFVT TGIRDKKGVT VKTKSLEPID ALTEQLRKLV SFDQEDNCQV 

      1570       1580       1590       1600       1610       1620 
LYSKQDANQL PRALVRKLSS RSQSRVRNIA SRAKEKQEAN KQKVPNPSNG AGVVLRNKPS 

      1630       1640       1650       1660       1670       1680 
APTPAVNRHS TGSYIAGYLK NTKGGGLEGR GIPEGACTAL HYGHVDQFCS DNSVLQTEPS 

      1690 
SDDKPEIYFL LRL 

« Hide

Isoform 2 [UniParc].

Checksum: 42135E91A9064CEF
Show »

FASTA1,655184,863
Isoform 3 (PLC-eta-1a) [UniParc].

Checksum: 333C3E46F453A55D
Show »

FASTA1,002114,506
Isoform 4 [UniParc].

Checksum: 74AA8EB84E16050F
Show »

FASTA1,014115,945

References

« Hide 'large scale' references
[1]"Molecular cloning and characterization of a novel phospholipase C, PLC-eta."
Hwang J.-I., Oh Y.-S., Shin K.-J., Kim H., Ryu S.H., Suh P.-G.
Biochem. J. 389:181-186(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 926-1693 (ISOFORM 1).
Tissue: Eye and Testis.
[3]"Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 216-1693 (ISOFORM 3).
Tissue: Brain.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 392-1034 (ISOFORM 4).
[5]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1470-1693 (ISOFORMS 1/2).
Tissue: Testis.
[6]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY691170 mRNA. Translation: AAW22607.1.
AY691171 mRNA. Translation: AAW22608.1.
BC043248 mRNA. Translation: AAH43248.2.
BC113950 mRNA. Translation: AAI13951.1.
AB028992 mRNA. Translation: BAA83021.1.
AK022610 mRNA. Translation: BAB14129.1. Different initiation.
CR749869 mRNA. Translation: CAH18710.1.
CCDSCCDS33881.1. [Q4KWH8-2]
CCDS46939.1. [Q4KWH8-1]
CCDS46940.1. [Q4KWH8-3]
RefSeqNP_001124432.1. NM_001130960.1. [Q4KWH8-1]
NP_001124433.1. NM_001130961.1. [Q4KWH8-3]
NP_055811.1. NM_014996.2. [Q4KWH8-2]
UniGeneHs.567423.

3D structure databases

ProteinModelPortalQ4KWH8.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116651. 1 interaction.
IntActQ4KWH8. 1 interaction.
STRING9606.ENSP00000345988.

PTM databases

PhosphoSiteQ4KWH8.

Polymorphism databases

DMDM121947010.

Proteomic databases

MaxQBQ4KWH8.
PaxDbQ4KWH8.
PRIDEQ4KWH8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000334686; ENSP00000335469; ENSG00000114805. [Q4KWH8-2]
ENST00000340059; ENSP00000345988; ENSG00000114805. [Q4KWH8-1]
ENST00000414191; ENSP00000412977; ENSG00000114805. [Q4KWH8-2]
ENST00000447496; ENSP00000402759; ENSG00000114805. [Q4KWH8-3]
ENST00000460012; ENSP00000417502; ENSG00000114805. [Q4KWH8-2]
ENST00000494598; ENSP00000419100; ENSG00000114805. [Q4KWH8-4]
GeneID23007.
KEGGhsa:23007.
UCSCuc021xgd.1. human. [Q4KWH8-3]
uc021xge.1. human. [Q4KWH8-1]
uc021xgf.1. human. [Q4KWH8-2]

Organism-specific databases

CTD23007.
GeneCardsGC03M155094.
H-InvDBHIX0119148.
HGNCHGNC:29185. PLCH1.
HPAHPA036176.
MIM612835. gene.
neXtProtNX_Q4KWH8.
PharmGKBPA128394595.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG149692.
HOVERGENHBG095591.
InParanoidQ4KWH8.
OMAIEDECKF.
OrthoDBEOG7PGDQ0.
PhylomeDBQ4KWH8.
TreeFamTF313216.

Enzyme and pathway databases

BRENDA3.1.4.11. 2681.
ReactomeREACT_111217. Metabolism.

Gene expression databases

BgeeQ4KWH8.
CleanExHS_PLCH1.
GenevestigatorQ4KWH8.

Family and domain databases

Gene3D1.10.238.10. 2 hits.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR028392. PLC-eta1.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR001849. Pleckstrin_homology.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF51. PTHR10336:SF51. 1 hit.
PfamPF00168. C2. 1 hit.
PF13499. EF-hand_7. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view]
PRINTSPR00390. PHPHLIPASEC.
SMARTSM00239. C2. 1 hit.
SM00054. EFh. 2 hits.
SM00233. PH. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEPS50004. C2. 1 hit.
PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 3 hits.
PS50003. PH_DOMAIN. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi23007.
NextBio43921.
PROQ4KWH8.
SOURCESearch...

Entry information

Entry namePLCH1_HUMAN
AccessionPrimary (citable) accession number: Q4KWH8
Secondary accession number(s): Q29RV9 expand/collapse secondary AC list , Q4KWH9, Q68CN0, Q86XK4, Q9H9U2, Q9UPT3
Entry history
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: August 2, 2005
Last modified: July 9, 2014
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM