Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q4KWH8

- PLCH1_HUMAN

UniProt

Q4KWH8 - PLCH1_HUMAN

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1

Gene

PLCH1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 97 (01 Oct 2014)
      Sequence version 1 (02 Aug 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by calcium-activated phosphatidylinositol-specific phospholipase C enzymes.1 Publication

    Catalytic activityi

    1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

    Cofactori

    Calcium.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei314 – 3141PROSITE-ProRule annotation
    Metal bindingi315 – 3151Calcium 1; catalyticBy similarity
    Metal bindingi344 – 3441Calcium 1; catalyticBy similarity
    Metal bindingi346 – 3461Calcium 1; catalyticBy similarity
    Active sitei358 – 3581PROSITE-ProRule annotation
    Metal bindingi393 – 3931Calcium 1; catalyticBy similarity
    Binding sitei442 – 4421SubstrateBy similarity
    Binding sitei444 – 4441SubstrateBy similarity
    Binding sitei627 – 6271SubstrateBy similarity
    Binding sitei654 – 6541SubstrateBy similarity
    Metal bindingi758 – 7581Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi760 – 7601Calcium 2By similarity
    Metal bindingi784 – 7841Calcium 2By similarity
    Metal bindingi813 – 8131Calcium 3By similarity
    Metal bindingi814 – 8141Calcium 3; via carbonyl oxygenBy similarity
    Metal bindingi815 – 8151Calcium 3By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Calcium bindingi155 – 16612PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. calcium-dependent phospholipase C activity Source: MGI
    2. calcium ion binding Source: InterPro
    3. phosphatidylinositol phospholipase C activity Source: UniProtKB-EC
    4. signal transducer activity Source: UniProtKB-KW

    GO - Biological processi

    1. inositol phosphate metabolic process Source: Reactome
    2. lipid catabolic process Source: UniProtKB-KW
    3. phosphatidylinositol-mediated signaling Source: MGI
    4. small molecule metabolic process Source: Reactome

    Keywords - Molecular functioni

    Hydrolase, Transducer

    Keywords - Biological processi

    Lipid degradation, Lipid metabolism

    Keywords - Ligandi

    Calcium, Metal-binding

    Enzyme and pathway databases

    BRENDAi3.1.4.11. 2681.
    ReactomeiREACT_150312. Synthesis of IP3 and IP4 in the cytosol.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 (EC:3.1.4.11)
    Alternative name(s):
    Phosphoinositide phospholipase C-eta-1
    Phospholipase C-eta-1
    Short name:
    PLC-eta-1
    Phospholipase C-like protein 3
    Short name:
    PLC-L3
    Gene namesi
    Name:PLCH1
    Synonyms:KIAA1069, PLCL3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:29185. PLCH1.

    Subcellular locationi

    Cytoplasm 1 Publication. Membrane 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: MGI
    2. cytosol Source: Ensembl
    3. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cytoplasm, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA128394595.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 169316931-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1PRO_0000329007Add
    BLAST

    Proteomic databases

    MaxQBiQ4KWH8.
    PaxDbiQ4KWH8.
    PRIDEiQ4KWH8.

    PTM databases

    PhosphoSiteiQ4KWH8.

    Expressioni

    Tissue specificityi

    Expressed in brain and to a lower extent in lung. In brain, it is found in cerebrum, cerebellum and spinal cord.1 Publication

    Gene expression databases

    BgeeiQ4KWH8.
    CleanExiHS_PLCH1.
    GenevestigatoriQ4KWH8.

    Organism-specific databases

    HPAiHPA036176.

    Interactioni

    Protein-protein interaction databases

    BioGridi116651. 1 interaction.
    IntActiQ4KWH8. 1 interaction.
    STRINGi9606.ENSP00000345988.

    Structurei

    3D structure databases

    ProteinModelPortaliQ4KWH8.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini20 – 128109PHPROSITE-ProRule annotationAdd
    BLAST
    Domaini142 – 17736EF-hand 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini178 – 21437EF-hand 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini299 – 444146PI-PLC X-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini601 – 714114PI-PLC Y-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini719 – 826108C2PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1026 – 10305Poly-Ser

    Sequence similaritiesi

    Contains 1 C2 domain.PROSITE-ProRule annotation
    Contains 2 EF-hand domains.PROSITE-ProRule annotation
    Contains 1 PH domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG149692.
    HOVERGENiHBG095591.
    InParanoidiQ4KWH8.
    OMAiIEDECKF.
    OrthoDBiEOG7PGDQ0.
    PhylomeDBiQ4KWH8.
    TreeFamiTF313216.

    Family and domain databases

    Gene3Di1.10.238.10. 2 hits.
    2.30.29.30. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProiIPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR001192. PI-PLC_fam.
    IPR028392. PLC-eta1.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view]
    PANTHERiPTHR10336. PTHR10336. 1 hit.
    PTHR10336:SF51. PTHR10336:SF51. 1 hit.
    PfamiPF00168. C2. 1 hit.
    PF13499. EF-hand_7. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    [Graphical view]
    PRINTSiPR00390. PHPHLIPASEC.
    SMARTiSM00239. C2. 1 hit.
    SM00054. EFh. 2 hits.
    SM00233. PH. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 2 hits.
    PROSITEiPS50004. C2. 1 hit.
    PS00018. EF_HAND_1. 1 hit.
    PS50222. EF_HAND_2. 3 hits.
    PS50003. PH_DOMAIN. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q4KWH8-1) [UniParc]FASTAAdd to Basket

    Also known as: PLC-eta-1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MADLEVYKNL SPEKVERCMS VMQSGTQMIK LKRGTKGLVR LFYLDEHRTR     50
    LRWRPSRKSE KAKILIDSIY KVTEGRQSEI FHRQAEGNFD PSCCFTIYHG 100
    NHMESLDLIT SNPEEARTWI TGLKYLMAGI SDEDSLAKRQ RTHDQWVKQT 150
    FEEADKNGDG LLNIEEIHQL MHKLNVNLPR RKVRQMFQEA DTDENQGTLT 200
    FEEFCVFYKM MSLRRDLYLL LLSYSDKKDH LTVEELAQFL KVEQKMNNVT 250
    TDYCLDIIKK FEVSEENKVK NVLGIEGFTN FMRSPACDIF NPLHHEVYQD 300
    MDQPLCNYYI ASSHNTYLTG DQLLSQSKVD MYARVLQEGC RCVEVDCWDG 350
    PDGEPVVHHG YTLTSKILFR DVVETINKHA FVKNEFPVIL SIENHCSIQQ 400
    QRKIAQYLKG IFGDKLDLSS VDTGECKQLP SPQSLKGKIL VKGKKLPYHL 450
    GDDAEEGEVS DEDSADEIED ECKFKLHYSN GTTEHQVESF IRKKLESLLK 500
    ESQIRDKEDP DSFTVRALLK ATHEGLNAHL KQSPDVKESG KKSHGRSLMT 550
    NFGKHKKTTK SRSKSYSTDD EEDTQQSTGK EGGQLYRLGR RRKTMKLCRE 600
    LSDLVVYTNS VAAQDIVDDG TTGNVLSFSE TRAHQVVQQK SEQFMIYNQK 650
    QLTRIYPSAY RIDSSNFNPL PYWNAGCQLV ALNYQSEGRM MQLNRAKFKA 700
    NGNCGYVLKP QQMCKGTFNP FSGDPLPANP KKQLILKVIS GQQLPKPPDS 750
    MFGDRGEIID PFVEVEIIGL PVDCCKDQTR VVDDNGFNPV WEETLTFTVH 800
    MPEIALVRFL VWDHDPIGRD FVGQRTVTFS SLVPGYRHVY LEGLTEASIF 850
    VHITINEIYG KWSPLILNPS YTILHFLGAT KNRQLQGLKG LFNKNPRHSS 900
    SENNSHYVRK RSIGDRILRR TASAPAKGRK KSKMGFQEMV EIKDSVSEAT 950
    RDQDGVLRRT TRSLQARPVS MPVDRNLLGA LSLPVSETAK DIEGKENSLA 1000
    EDKDGRRKGK ASIKDPHFLN FNKKLSSSSS ALLHKDTSQG DTIVSTAHMS 1050
    VTGEQLGMSS PRGGRTTSNA TSNCQENPCP SKSLSPKQHL APDPVVNPTQ 1100
    DLHGVKIKEK GNPEDFVEGK SILSGSVLSH SNLEIKNLEG NRGKGRAATS 1150
    FSLSDVSMLC SDIPDLHSTA ILQESVISHL IDNVTLTNEN EPGSSISALI 1200
    GQFDETNNQA LTVVSHLHNT SVMSGHCPLP SLGLKMPIKH GFCKGKSKSS 1250
    FLCSSPELIA LSSSETTKHA TNTVYETTCT PISKTKPDDD LSSKAKTAAL 1300
    ESNLPGSPNT SRGWLPKSPT KGEDWETLKS CSPASSPDLT LEDVIADPTL 1350
    CFNSGESSLV EIDGESENLS LTTCEYRREG TSQLASPLKL KYNQGVVEHF 1400
    QRGLRNGYCK ETLRPSVPEI FNNIQDVKTQ SISYLAYQGA GFVHNHFSDS 1450
    DAKMFQTCVP QQSSAQDMHV PVPKQLAHLP LPALKLPSPC KSKSLGDLTS 1500
    EDIACNFESK YQCISKSFVT TGIRDKKGVT VKTKSLEPID ALTEQLRKLV 1550
    SFDQEDNCQV LYSKQDANQL PRALVRKLSS RSQSRVRNIA SRAKEKQEAN 1600
    KQKVPNPSNG AGVVLRNKPS APTPAVNRHS TGSYIAGYLK NTKGGGLEGR 1650
    GIPEGACTAL HYGHVDQFCS DNSVLQTEPS SDDKPEIYFL LRL 1693
    Length:1,693
    Mass (Da):189,223
    Last modified:August 2, 2005 - v1
    Checksum:i00F2ADD21C4D14E6
    GO
    Isoform 2 (identifier: Q4KWH8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-18: Missing.
         862-881: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,655
    Mass (Da):184,863
    Checksum:i42135E91A9064CEF
    GO
    Isoform 3 (identifier: Q4KWH8-3) [UniParc]FASTAAdd to Basket

    Also known as: PLC-eta-1a

    The sequence of this isoform differs from the canonical sequence as follows:
         1000-1002: AED → VQI
         1003-1693: Missing.

    Show »
    Length:1,002
    Mass (Da):114,506
    Checksum:i333C3E46F453A55D
    GO
    Isoform 4 (identifier: Q4KWH8-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         862-881: Missing.
         1000-1034: AEDKDGRRKGKASIKDPHFLNFNKKLSSSSSALLH → DSSFCRPTEQAKAEMCKVPFPRQLECVMKMEISET
         1035-1693: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,014
    Mass (Da):115,945
    Checksum:i74AA8EB84E16050F
    GO

    Sequence cautioni

    The sequence BAB14129.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1818Missing in isoform 2. 1 PublicationVSP_032901Add
    BLAST
    Alternative sequencei862 – 88120Missing in isoform 2 and isoform 4. 2 PublicationsVSP_032902Add
    BLAST
    Alternative sequencei1000 – 103435AEDKD…SALLH → DSSFCRPTEQAKAEMCKVPF PRQLECVMKMEISET in isoform 4. 1 PublicationVSP_032903Add
    BLAST
    Alternative sequencei1000 – 10023AED → VQI in isoform 3. 2 PublicationsVSP_032904
    Alternative sequencei1003 – 1693691Missing in isoform 3. 2 PublicationsVSP_032905Add
    BLAST
    Alternative sequencei1035 – 1693659Missing in isoform 4. 1 PublicationVSP_032906Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY691170 mRNA. Translation: AAW22607.1.
    AY691171 mRNA. Translation: AAW22608.1.
    BC043248 mRNA. Translation: AAH43248.2.
    BC113950 mRNA. Translation: AAI13951.1.
    AB028992 mRNA. Translation: BAA83021.1.
    AK022610 mRNA. Translation: BAB14129.1. Different initiation.
    CR749869 mRNA. Translation: CAH18710.1.
    CCDSiCCDS33881.1. [Q4KWH8-2]
    CCDS46939.1. [Q4KWH8-1]
    CCDS46940.1. [Q4KWH8-3]
    RefSeqiNP_001124432.1. NM_001130960.1. [Q4KWH8-1]
    NP_001124433.1. NM_001130961.1. [Q4KWH8-3]
    NP_055811.1. NM_014996.2. [Q4KWH8-2]
    UniGeneiHs.567423.

    Genome annotation databases

    EnsembliENST00000334686; ENSP00000335469; ENSG00000114805. [Q4KWH8-2]
    ENST00000340059; ENSP00000345988; ENSG00000114805. [Q4KWH8-1]
    ENST00000447496; ENSP00000402759; ENSG00000114805. [Q4KWH8-3]
    ENST00000460012; ENSP00000417502; ENSG00000114805. [Q4KWH8-2]
    ENST00000494598; ENSP00000419100; ENSG00000114805. [Q4KWH8-4]
    GeneIDi23007.
    KEGGihsa:23007.
    UCSCiuc021xgd.1. human. [Q4KWH8-3]
    uc021xge.1. human. [Q4KWH8-1]
    uc021xgf.1. human. [Q4KWH8-2]

    Polymorphism databases

    DMDMi121947010.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY691170 mRNA. Translation: AAW22607.1 .
    AY691171 mRNA. Translation: AAW22608.1 .
    BC043248 mRNA. Translation: AAH43248.2 .
    BC113950 mRNA. Translation: AAI13951.1 .
    AB028992 mRNA. Translation: BAA83021.1 .
    AK022610 mRNA. Translation: BAB14129.1 . Different initiation.
    CR749869 mRNA. Translation: CAH18710.1 .
    CCDSi CCDS33881.1. [Q4KWH8-2 ]
    CCDS46939.1. [Q4KWH8-1 ]
    CCDS46940.1. [Q4KWH8-3 ]
    RefSeqi NP_001124432.1. NM_001130960.1. [Q4KWH8-1 ]
    NP_001124433.1. NM_001130961.1. [Q4KWH8-3 ]
    NP_055811.1. NM_014996.2. [Q4KWH8-2 ]
    UniGenei Hs.567423.

    3D structure databases

    ProteinModelPortali Q4KWH8.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116651. 1 interaction.
    IntActi Q4KWH8. 1 interaction.
    STRINGi 9606.ENSP00000345988.

    PTM databases

    PhosphoSitei Q4KWH8.

    Polymorphism databases

    DMDMi 121947010.

    Proteomic databases

    MaxQBi Q4KWH8.
    PaxDbi Q4KWH8.
    PRIDEi Q4KWH8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000334686 ; ENSP00000335469 ; ENSG00000114805 . [Q4KWH8-2 ]
    ENST00000340059 ; ENSP00000345988 ; ENSG00000114805 . [Q4KWH8-1 ]
    ENST00000447496 ; ENSP00000402759 ; ENSG00000114805 . [Q4KWH8-3 ]
    ENST00000460012 ; ENSP00000417502 ; ENSG00000114805 . [Q4KWH8-2 ]
    ENST00000494598 ; ENSP00000419100 ; ENSG00000114805 . [Q4KWH8-4 ]
    GeneIDi 23007.
    KEGGi hsa:23007.
    UCSCi uc021xgd.1. human. [Q4KWH8-3 ]
    uc021xge.1. human. [Q4KWH8-1 ]
    uc021xgf.1. human. [Q4KWH8-2 ]

    Organism-specific databases

    CTDi 23007.
    GeneCardsi GC03M155094.
    H-InvDB HIX0119148.
    HGNCi HGNC:29185. PLCH1.
    HPAi HPA036176.
    MIMi 612835. gene.
    neXtProti NX_Q4KWH8.
    PharmGKBi PA128394595.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG149692.
    HOVERGENi HBG095591.
    InParanoidi Q4KWH8.
    OMAi IEDECKF.
    OrthoDBi EOG7PGDQ0.
    PhylomeDBi Q4KWH8.
    TreeFami TF313216.

    Enzyme and pathway databases

    BRENDAi 3.1.4.11. 2681.
    Reactomei REACT_150312. Synthesis of IP3 and IP4 in the cytosol.

    Miscellaneous databases

    GenomeRNAii 23007.
    NextBioi 43921.
    PROi Q4KWH8.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q4KWH8.
    CleanExi HS_PLCH1.
    Genevestigatori Q4KWH8.

    Family and domain databases

    Gene3Di 1.10.238.10. 2 hits.
    2.30.29.30. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProi IPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR001192. PI-PLC_fam.
    IPR028392. PLC-eta1.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view ]
    PANTHERi PTHR10336. PTHR10336. 1 hit.
    PTHR10336:SF51. PTHR10336:SF51. 1 hit.
    Pfami PF00168. C2. 1 hit.
    PF13499. EF-hand_7. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    [Graphical view ]
    PRINTSi PR00390. PHPHLIPASEC.
    SMARTi SM00239. C2. 1 hit.
    SM00054. EFh. 2 hits.
    SM00233. PH. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 2 hits.
    PROSITEi PS50004. C2. 1 hit.
    PS00018. EF_HAND_1. 1 hit.
    PS50222. EF_HAND_2. 3 hits.
    PS50003. PH_DOMAIN. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and characterization of a novel phospholipase C, PLC-eta."
      Hwang J.-I., Oh Y.-S., Shin K.-J., Kim H., Ryu S.H., Suh P.-G.
      Biochem. J. 389:181-186(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 926-1693 (ISOFORM 1).
      Tissue: Eye and Testis.
    3. "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 216-1693 (ISOFORM 3).
      Tissue: Brain.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 392-1034 (ISOFORM 4).
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1470-1693 (ISOFORMS 1/2).
      Tissue: Testis.
    6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiPLCH1_HUMAN
    AccessioniPrimary (citable) accession number: Q4KWH8
    Secondary accession number(s): Q29RV9
    , Q4KWH9, Q68CN0, Q86XK4, Q9H9U2, Q9UPT3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 8, 2008
    Last sequence update: August 2, 2005
    Last modified: October 1, 2014
    This is version 97 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3