Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box/WD repeat-containing protein 5

Gene

Fbxw5

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Substrate recognition component of both SCF (SKP1-CUL1-F-box protein) and DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes. Substrate recognition component of the SCF(FBXW5) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of SASS6 during S phase, leading to prevent centriole reduplication. The SCF(FBXW5) complex also mediates ubiquitination and degradation of actin-regulator EPS8 during G2 phase, leading to the transient degradation of EPS8 and subsequent cell shape changes required to allow mitotic progression. Substrate-specific adapter of the DCX(FBXW5) E3 ubiquitin-protein ligase complex which mediates the polyubiquitination and subsequent degradation of TSC2. May also act as a negative regulator of MAP3K7/TAK1 signaling in the interleukin-1B (IL1B) signaling pathway (By similarity).By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
F-box/WD repeat-containing protein 5
Alternative name(s):
F-box and WD-40 domain-containing protein 5
Gene namesi
Name:Fbxw5
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 3

Organism-specific databases

RGDi1305661. Fbxw5.

Subcellular locationi

  • Cytoplasm By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 569569F-box/WD repeat-containing protein 5PRO_0000292805Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei151 – 1511Phosphoserine; by PLK4By similarity

Post-translational modificationi

Phosphorylated at Ser-151 by PLK4 during the G1/S transition, leading to inhibit its ability to ubiquitinate SASS6.By similarity
Ubiquitinated and degraded by the APC/C complex during mitosis and G1 phase.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ4KLI9.
PRIDEiQ4KLI9.

PTM databases

PhosphoSiteiQ4KLI9.

Expressioni

Gene expression databases

GenevisibleiQ4KLI9. RN.

Interactioni

Subunit structurei

Part of the SCF (SKP1-CUL1-F-box) E3 ubiquitin-protein ligase complex SCF(FBXW5) composed of CUL1, SKP1, RBX1 and FBXW5. Component of the DCX(FBXW5) E3 ubiquitin ligase complex, at least composed of (CUL4A or CUL4B), DDB1, FBXW5 and RBX1. Interacts with CDC20, EPS8, TSC1, TSC2 and SASS6.Interacts with TNFAIP8L1; TNFAIP8L1 competes with TSC2 to bind FBXW5 increasing TSC2 stability by preventing its ubiquitination.By similarity

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000049492.

Structurei

3D structure databases

ProteinModelPortaliQ4KLI9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini3 – 4947F-boxPROSITE-ProRule annotationAdd
BLAST
Repeati90 – 12940WD 1Add
BLAST
Repeati470 – 50940WD 2Add
BLAST
Repeati511 – 55141WD 3Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi308 – 3169D-box

Domaini

The F-box domain mediates interaction with components of SCF (SKP1-CUL1-F-box protein) complexes, while WD repeats mediate interaction with components of DCX (DDB1-CUL4-X-box) complexes.By similarity
The D-box (destruction box) mediate the interaction with APC proteins, and acts as a recognition signal for degradation via the ubiquitin-proteasome pathway.By similarity

Sequence similaritiesi

Belongs to the FBXW5 family.Curated
Contains 1 F-box domain.PROSITE-ProRule annotation
Contains 3 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiENOG410IEAX. Eukaryota.
ENOG410XTK0. LUCA.
GeneTreeiENSGT00730000111276.
HOGENOMiHOG000231549.
HOVERGENiHBG051595.
InParanoidiQ4KLI9.
KOiK10263.
OMAiYDIFGTW.
OrthoDBiEOG7RZ5PB.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR001810. F-box_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF12937. F-box-like. 1 hit.
PF00400. WD40. 2 hits.
[Graphical view]
SMARTiSM00256. FBOX. 1 hit.
SM00320. WD40. 3 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 2 hits.
SSF81383. SSF81383. 2 hits.
PROSITEiPS50181. FBOX. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q4KLI9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDEGGMPLLP DSLVYQIFLS LGPADVLAAG LVCRQWQAVS RDEFLWREQF
60 70 80 90 100
YRYYQVARDV PRHPAATSWY EEFRRLYDMV PCVEVQTLKE HTDQVLHLSF
110 120 130 140 150
SHSGYQFASC SKDCTVKIWN NDLTISLLHS ADMRPYNWSY TQFSQFNQDD
160 170 180 190 200
SLLLASGVFL GPHNSSSGEI AVISLDSFAL LSRVRNKPYD VFGCWLTETS
210 220 230 240 250
LISGNLHRIG DVTSCSVLWL NNAFQDVESE NVNVVKRLFK IQNLNASTIR
260 270 280 290 300
TVMVADCSRF DSPDLLLDAG DQAGLPCRVF DLGGDTEEEA TDPGLHTSGS
310 320 330 340 350
GHVKEGLRRV FDSVLDGHGQ LSDCALETKV AELLAQGHTK PPECPDADSR
360 370 380 390 400
NKYLIFTTGC LTYSPHQIGI KQILPHQMTT AGPVLGEGRG SDAFFDALDH
410 420 430 440 450
VIDVHGHIIG MGLSPDNRYL YVNSRAWPPG SVVADPMQPP PIAEEIDLLV
460 470 480 490 500
FDLKTMREVK RALRAHRAYT PNDECFFIFL DVSRDFVASG AEDRHGYIWD
510 520 530 540 550
RHYNICLAKL RHEDVVNSVA FSPQEQELLL TASDDATIKA WRSPRIVRVL
560
QAPHPRPRPF FSWFASHRR
Length:569
Mass (Da):64,034
Last modified:August 2, 2005 - v1
Checksum:i344C77FB90715728
GO
Isoform 2 (identifier: Q4KLI9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLSAMEFSAGQLVGLARTAMSGTPDHQSLPGVGGEEAWVESSHWWVSGPSGQNVTM

Note: No experimental confirmation available.
Show »
Length:624
Mass (Da):69,746
Checksum:i625F64CC719C4281
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MLSAMEFSAGQLVGLARTAM SGTPDHQSLPGVGGEEAWVE SSHWWVSGPSGQNVTM in isoform 2. 1 PublicationVSP_042295

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC099179 mRNA. Translation: AAH99179.1.
RefSeqiNP_001020901.1. NM_001025730.2. [Q4KLI9-1]
XP_006233685.1. XM_006233623.2. [Q4KLI9-2]
XP_006233686.1. XM_006233624.2. [Q4KLI9-1]
XP_006233687.1. XM_006233625.2. [Q4KLI9-1]
XP_006233688.1. XM_006233626.2. [Q4KLI9-1]
XP_006233689.1. XM_006233627.2. [Q4KLI9-1]
UniGeneiRn.136952.

Genome annotation databases

EnsembliENSRNOT00000034089; ENSRNOP00000029229; ENSRNOG00000028674. [Q4KLI9-1]
GeneIDi362081.
KEGGirno:362081.
UCSCiRGD:1305661. rat. [Q4KLI9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC099179 mRNA. Translation: AAH99179.1.
RefSeqiNP_001020901.1. NM_001025730.2. [Q4KLI9-1]
XP_006233685.1. XM_006233623.2. [Q4KLI9-2]
XP_006233686.1. XM_006233624.2. [Q4KLI9-1]
XP_006233687.1. XM_006233625.2. [Q4KLI9-1]
XP_006233688.1. XM_006233626.2. [Q4KLI9-1]
XP_006233689.1. XM_006233627.2. [Q4KLI9-1]
UniGeneiRn.136952.

3D structure databases

ProteinModelPortaliQ4KLI9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000049492.

PTM databases

PhosphoSiteiQ4KLI9.

Proteomic databases

PaxDbiQ4KLI9.
PRIDEiQ4KLI9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000034089; ENSRNOP00000029229; ENSRNOG00000028674. [Q4KLI9-1]
GeneIDi362081.
KEGGirno:362081.
UCSCiRGD:1305661. rat. [Q4KLI9-1]

Organism-specific databases

CTDi54461.
RGDi1305661. Fbxw5.

Phylogenomic databases

eggNOGiENOG410IEAX. Eukaryota.
ENOG410XTK0. LUCA.
GeneTreeiENSGT00730000111276.
HOGENOMiHOG000231549.
HOVERGENiHBG051595.
InParanoidiQ4KLI9.
KOiK10263.
OMAiYDIFGTW.
OrthoDBiEOG7RZ5PB.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

NextBioi678578.
PROiQ4KLI9.

Gene expression databases

GenevisibleiQ4KLI9. RN.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR001810. F-box_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF12937. F-box-like. 1 hit.
PF00400. WD40. 2 hits.
[Graphical view]
SMARTiSM00256. FBOX. 1 hit.
SM00320. WD40. 3 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 2 hits.
SSF81383. SSF81383. 2 hits.
PROSITEiPS50181. FBOX. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Genome sequence of the Brown Norway rat yields insights into mammalian evolution."
    Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J., Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G., Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G., Morgan M.
    , Hawes A., Gill R., Holt R.A., Adams M.D., Amanatides P.G., Baden-Tillson H., Barnstead M., Chin S., Evans C.A., Ferriera S., Fosler C., Glodek A., Gu Z., Jennings D., Kraft C.L., Nguyen T., Pfannkoch C.M., Sitter C., Sutton G.G., Venter J.C., Woodage T., Smith D., Lee H.-M., Gustafson E., Cahill P., Kana A., Doucette-Stamm L., Weinstock K., Fechtel K., Weiss R.B., Dunn D.M., Green E.D., Blakesley R.W., Bouffard G.G., De Jong P.J., Osoegawa K., Zhu B., Marra M., Schein J., Bosdet I., Fjell C., Jones S., Krzywinski M., Mathewson C., Siddiqui A., Wye N., McPherson J., Zhao S., Fraser C.M., Shetty J., Shatsman S., Geer K., Chen Y., Abramzon S., Nierman W.C., Havlak P.H., Chen R., Durbin K.J., Egan A., Ren Y., Song X.-Z., Li B., Liu Y., Qin X., Cawley S., Cooney A.J., D'Souza L.M., Martin K., Wu J.Q., Gonzalez-Garay M.L., Jackson A.R., Kalafus K.J., McLeod M.P., Milosavljevic A., Virk D., Volkov A., Wheeler D.A., Zhang Z., Bailey J.A., Eichler E.E., Tuzun E., Birney E., Mongin E., Ureta-Vidal A., Woodwark C., Zdobnov E., Bork P., Suyama M., Torrents D., Alexandersson M., Trask B.J., Young J.M., Huang H., Wang H., Xing H., Daniels S., Gietzen D., Schmidt J., Stevens K., Vitt U., Wingrove J., Camara F., Mar Alba M., Abril J.F., Guigo R., Smit A., Dubchak I., Rubin E.M., Couronne O., Poliakov A., Huebner N., Ganten D., Goesele C., Hummel O., Kreitler T., Lee Y.-A., Monti J., Schulz H., Zimdahl H., Himmelbauer H., Lehrach H., Jacob H.J., Bromberg S., Gullings-Handley J., Jensen-Seaman M.I., Kwitek A.E., Lazar J., Pasko D., Tonellato P.J., Twigger S., Ponting C.P., Duarte J.M., Rice S., Goodstadt L., Beatson S.A., Emes R.D., Winter E.E., Webber C., Brandt P., Nyakatura G., Adetobi M., Chiaromonte F., Elnitski L., Eswara P., Hardison R.C., Hou M., Kolbe D., Makova K., Miller W., Nekrutenko A., Riemer C., Schwartz S., Taylor J., Yang S., Zhang Y., Lindpaintner K., Andrews T.D., Caccamo M., Clamp M., Clarke L., Curwen V., Durbin R.M., Eyras E., Searle S.M., Cooper G.M., Batzoglou S., Brudno M., Sidow A., Stone E.A., Payseur B.A., Bourque G., Lopez-Otin C., Puente X.S., Chakrabarti K., Chatterji S., Dewey C., Pachter L., Bray N., Yap V.B., Caspi A., Tesler G., Pevzner P.A., Haussler D., Roskin K.M., Baertsch R., Clawson H., Furey T.S., Hinrichs A.S., Karolchik D., Kent W.J., Rosenbloom K.R., Trumbower H., Weirauch M., Cooper D.N., Stenson P.D., Ma B., Brent M., Arumugam M., Shteynberg D., Copley R.R., Taylor M.S., Riethman H., Mudunuri U., Peterson J., Guyer M., Felsenfeld A., Old S., Mockrin S., Collins F.S.
    Nature 428:493-521(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Brown Norway.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Thymus.

Entry informationi

Entry nameiFBXW5_RAT
AccessioniPrimary (citable) accession number: Q4KLI9
Secondary accession number(s): F8WFL5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: August 2, 2005
Last modified: December 9, 2015
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.