Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor MYB59

Gene

MYB59

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Transcription factor.Curated

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi33 – 5725H-T-H motifPROSITE-ProRule annotationAdd
BLAST
DNA bindingi85 – 10824H-T-H motifPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • transcription factor activity, sequence-specific DNA binding Source: TAIR

GO - Biological processi

  • response to cadmium ion Source: TAIR
  • response to chitin Source: TAIR
  • response to ethylene Source: TAIR
  • response to gibberellin Source: TAIR
  • response to jasmonic acid Source: TAIR
  • response to salicylic acid Source: TAIR
  • transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor MYB59
Alternative name(s):
Myb-related protein 59
Short name:
AtMYB59
Gene namesi
Name:MYB59
Ordered Locus Names:At5g59780
ORF Names:MTH12.19
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 5

Organism-specific databases

TAIRiAT5G59780.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation1 Publication

  • Note: Isoform MYB59-2 and isoform MYB59-3 (harboring both NLS1 and NLS2) are nuclear, werheas isoform MYB59-1 (harboring NLS2) and isoform MYB59-4 (harboring NLS1) are partially nuclear.

GO - Cellular componenti

  • nucleus Source: TAIR
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 235235Transcription factor MYB59PRO_0000234359Add
BLAST

Proteomic databases

PaxDbiQ4JL84.
PRIDEiQ4JL84.

Expressioni

Tissue specificityi

Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings.1 Publication

Inductioni

Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd).2 Publications

Gene expression databases

GenevisibleiQ4JL84. AT.

Interactioni

Protein-protein interaction databases

STRINGi3702.AT5G59780.3.

Structurei

3D structure databases

ProteinModelPortaliQ4JL84.
SMRiQ4JL84. Positions 7-111.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini5 – 5753HTH myb-type 1PROSITE-ProRule annotationAdd
BLAST
Domaini58 – 11255HTH myb-type 2PROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi62 – 654Bipartite nuclear localization signal 1Sequence analysis
Motifi109 – 1179Bipartite nuclear localization signal 2Sequence analysis

Sequence similaritiesi

Contains 2 HTH myb-type DNA-binding domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0048. Eukaryota.
COG5147. LUCA.
InParanoidiQ4JL84.
KOiK09422.
OMAiAWESSME.
OrthoDBiEOG09360PCP.
PhylomeDBiQ4JL84.

Family and domain databases

Gene3Di1.10.10.60. 2 hits.
InterProiIPR009057. Homeodomain-like.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
[Graphical view]
PfamiPF00249. Myb_DNA-binding. 2 hits.
[Graphical view]
SMARTiSM00717. SANT. 2 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS51294. HTH_MYB. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform MYB59-3 (identifier: Q4JL84-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKLVQEEYRK GPWTEQEDIL LVNFVHLFGD RRWDFVAKVS GLNRTGKSCR
60 70 80 90 100
LRWVNYLHPG LKRGKMTPQE ERLVLELHAK WGNRWSKIAR KLPGRTDNEI
110 120 130 140 150
KNYWRTHMRK KAQEKKRPMS PTSSSSNCCS SSMTTTTSQD TGGSNGKMNQ
160 170 180 190 200
ECEDGYYSMD DIWREIDQSG ANVIKPVKDN YYSEQSCYLN FPPLASPTWE
210 220 230
SSLESIWNMD ADESKMSSFA IDQFPLSFEH GSGRL
Length:235
Mass (Da):27,237
Last modified:May 16, 2006 - v2
Checksum:i35DB85B37C7CFC66
GO
Isoform MYB59-1 (identifier: Q4JL84-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.

Show »
Length:170
Mass (Da):19,482
Checksum:i57B05A0262DAA9DE
GO
Isoform MYB59-2 (identifier: Q4JL84-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-40: KLVQEEYRKGPWTEQEDILLVNFVHLFGDRRWDFVAKVS → GFCSESFRFEGGGRNIRI

Show »
Length:214
Mass (Da):24,520
Checksum:iBDEFD33404DEDE46
GO
Isoform MYB59-4 (identifier: Q4JL84-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     67-215: Missing.

Show »
Length:86
Mass (Da):10,113
Checksum:i54C33CCBF2708358
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti138 – 1381S → T in AAC83616 (PubMed:9839469).Curated
Sequence conflicti152 – 1521C → G in AAC83616 (PubMed:9839469).Curated
Sequence conflicti171 – 1722AN → H in AAC83616 (PubMed:9839469).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6565Missing in isoform MYB59-1. 2 PublicationsVSP_018291Add
BLAST
Alternative sequencei2 – 4039KLVQE…VAKVS → GFCSESFRFEGGGRNIRI in isoform MYB59-2. 1 PublicationVSP_018292Add
BLAST
Alternative sequencei67 – 215149Missing in isoform MYB59-4. 1 PublicationVSP_018293Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF062894 mRNA. Translation: AAC83616.1.
AY519641 mRNA. Translation: AAS10111.1.
DQ075252 mRNA. Translation: AAY97894.1.
DQ075253 mRNA. Translation: AAY97895.1.
DQ075254 mRNA. Translation: AAY97896.1.
AB006705 Genomic DNA. Translation: BAB09515.1.
CP002688 Genomic DNA. Translation: AED97231.1.
CP002688 Genomic DNA. Translation: AED97232.1.
CP002688 Genomic DNA. Translation: AED97233.1.
AK229048 mRNA. Translation: BAF00931.1.
Z95781 mRNA. Translation: CAB09213.1.
Z95772 mRNA. Translation: CAB09204.1.
PIRiT51666.
RefSeqiNP_200786.1. NM_125370.3. [Q4JL84-1]
NP_851225.1. NM_180894.3. [Q4JL84-2]
NP_851226.1. NM_180895.2. [Q4JL84-3]
UniGeneiAt.22428.
At.70065.

Genome annotation databases

EnsemblPlantsiAT5G59780.3; AT5G59780.3; AT5G59780. [Q4JL84-1]
GeneIDi836099.
KEGGiath:AT5G59780.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF062894 mRNA. Translation: AAC83616.1.
AY519641 mRNA. Translation: AAS10111.1.
DQ075252 mRNA. Translation: AAY97894.1.
DQ075253 mRNA. Translation: AAY97895.1.
DQ075254 mRNA. Translation: AAY97896.1.
AB006705 Genomic DNA. Translation: BAB09515.1.
CP002688 Genomic DNA. Translation: AED97231.1.
CP002688 Genomic DNA. Translation: AED97232.1.
CP002688 Genomic DNA. Translation: AED97233.1.
AK229048 mRNA. Translation: BAF00931.1.
Z95781 mRNA. Translation: CAB09213.1.
Z95772 mRNA. Translation: CAB09204.1.
PIRiT51666.
RefSeqiNP_200786.1. NM_125370.3. [Q4JL84-1]
NP_851225.1. NM_180894.3. [Q4JL84-2]
NP_851226.1. NM_180895.2. [Q4JL84-3]
UniGeneiAt.22428.
At.70065.

3D structure databases

ProteinModelPortaliQ4JL84.
SMRiQ4JL84. Positions 7-111.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi3702.AT5G59780.3.

Proteomic databases

PaxDbiQ4JL84.
PRIDEiQ4JL84.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT5G59780.3; AT5G59780.3; AT5G59780. [Q4JL84-1]
GeneIDi836099.
KEGGiath:AT5G59780.

Organism-specific databases

TAIRiAT5G59780.

Phylogenomic databases

eggNOGiKOG0048. Eukaryota.
COG5147. LUCA.
InParanoidiQ4JL84.
KOiK09422.
OMAiAWESSME.
OrthoDBiEOG09360PCP.
PhylomeDBiQ4JL84.

Miscellaneous databases

PROiQ4JL84.

Gene expression databases

GenevisibleiQ4JL84. AT.

Family and domain databases

Gene3Di1.10.10.60. 2 hits.
InterProiIPR009057. Homeodomain-like.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
[Graphical view]
PfamiPF00249. Myb_DNA-binding. 2 hits.
[Graphical view]
SMARTiSM00717. SANT. 2 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
PROSITEiPS51294. HTH_MYB. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMYB59_ARATH
AccessioniPrimary (citable) accession number: Q4JL84
Secondary accession number(s): O50069
, Q0WPL8, Q4JL85, Q4JL86, Q7DLH5, Q9FN86
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: May 16, 2006
Last modified: September 7, 2016
This is version 92 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.