SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q4JDL3

- PTN20_HUMAN

UniProt

Q4JDL3 - PTN20_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tyrosine-protein phosphatase non-receptor type 20

Gene
PTPN20A
PTPN20B
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Tyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates.

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei323 – 3231Substrate By similarity
Active sitei353 – 3531Phosphocysteine intermediate By similarity
Binding sitei397 – 3971Substrate By similarity

GO - Molecular functioni

  1. protein tyrosine phosphatase activity Source: UniProtKB-EC
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Names & Taxonomyi

Organism-specific databases

Protein namesi
Recommended name:
Tyrosine-protein phosphatase non-receptor type 20 (EC:3.1.3.48)
Short name:
hPTPN20
Gene namesi
Name:PTPN20A
AND
Name:PTPN20B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10
HGNCiHGNC:23422. PTPN20A.
HGNC:23423. PTPN20B.

Subcellular locationi

Nucleus. Cytoplasm. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome
Note: Colocalizes with the microtubule-organizing center and intracellular membrane compartments.1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. microtubule Source: UniProtKB-KW
  3. microtubule organizing center Source: UniProtKB-SubCell
  4. nucleus Source: UniProtKB-SubCell

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134904835.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 420420Tyrosine-protein phosphatase non-receptor type 20PRO_0000295755Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei120 – 1201Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ4JDL3.
PRIDEiQ4JDL3.

PTM databases

PhosphoSiteiQ4JDL3.

Expressioni

Tissue specificityi

Present in many cell lines (at protein level). Widely expressed.1 Publication

Gene expression databases

BgeeiQ4JDL3.
CleanExiHS_PTPN20A.
GenevestigatoriQ4JDL3.

Organism-specific databases

HPAiHPA043337.
HPA046896.
HPA047055.
HPA048310.

Interactioni

Protein-protein interaction databases

BioGridi575548. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ4JDL3.
SMRiQ4JDL3. Positions 142-416.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini159 – 412254Tyrosine-protein phosphataseAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni353 – 3597Substrate binding By similarity

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG5599.
HOVERGENiHBG095763.
InParanoidiQ4JDL3.
KOiK18039.
OMAiFCAIVKN.
PhylomeDBiQ4JDL3.
TreeFamiTF315573.

Family and domain databases

Gene3Di3.90.190.10. 1 hit.
InterProiIPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view]
PfamiPF00102. Y_phosphatase. 1 hit.
[Graphical view]
PRINTSiPR00700. PRTYPHPHTASE.
SMARTiSM00194. PTPc. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50055. TYR_PHOSPHATASE_PTP. 1 hit.
[Graphical view]

Sequences (15)i

Sequence statusi: Complete.

This entry describes 15 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q4JDL3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSSPRDFRAE PVNDYEGNDS EAEDLNFRET LPSSSQENTP RSKVFENKVN    50
SEKVKLSLRN FPHNDYEDVF EEPSESGSDP SMWTARGPFR RDRWSSEDEE 100
AAGPSQALSP LLSDTRKIVS EGELDQLAQI RPLIFNFHEQ TAIKDCLKIL 150
EEKTAAYDIM QEFMALELKN LPGEFNSGNQ PSNREKNRYR DILPYDSTRV 200
PLGKSKDYIN ASYIRIVNCG EEYFYIATQG PLLSTIDDFW QMVLENNSNV 250
IAMITREIEG GIIKCYHYWP ISLKKPLELK HFRVFLENYQ ILQYFIIRMF 300
QVVEKSTGTS HSVKQLQFTK WPDHGTPASA DSFIKYIRYA RKSHLTGPMV 350
VHCSAGIGRT GVFLCVDVVF CAIVKNCSFN IMDIVAQMRE QRSGMVQTKE 400
QYHFCYDIVL EVLRKLLTLD 420
Length:420
Mass (Da):48,423
Last modified:August 2, 2005 - v1
Checksum:iF3A1C8041ACB710E
GO
Isoform 2 (identifier: Q4JDL3-2) [UniParc]FASTAAdd to Basket

Also known as: Variant 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI

Show »
Length:411
Mass (Da):47,393
Checksum:i84315BC1463CF896
GO
Isoform 3 (identifier: Q4JDL3-3) [UniParc]FASTAAdd to Basket

Also known as: Variant 10

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSK → MGTTCLHLGTLEQSL

Show »
Length:392
Mass (Da):45,123
Checksum:i0117231EAC24C57B
GO
Isoform 4 (identifier: Q4JDL3-4) [UniParc]FASTAAdd to Basket

Also known as: Variant 12

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.

Show »
Length:339
Mass (Da):39,184
Checksum:i33F1B10881A748C5
GO
Isoform 5 (identifier: Q4JDL3-5) [UniParc]FASTAAdd to Basket

Also known as: Variant 13

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     165-306: Missing.

Show »
Length:197
Mass (Da):22,439
Checksum:i75CC97D2E52F5EE4
GO
Isoform 6 (identifier: Q4JDL3-6) [UniParc]FASTAAdd to Basket

Also known as: Variant 3

The sequence of this isoform differs from the canonical sequence as follows:
     1-192: Missing.
     193-195: LPY → MID

Show »
Length:228
Mass (Da):26,374
Checksum:i7A416A64EF1E9D8C
GO
Isoform 7 (identifier: Q4JDL3-7) [UniParc]FASTAAdd to Basket

Also known as: Variant 7

The sequence of this isoform differs from the canonical sequence as follows:
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.

Show »
Length:226
Mass (Da):25,881
Checksum:i7E024F34E1952E10
GO
Isoform 8 (identifier: Q4JDL3-8) [UniParc]FASTAAdd to Basket

Also known as: Variant 4

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.

Show »
Length:217
Mass (Da):24,851
Checksum:iC4F0BC493F07E554
GO
Isoform 9 (identifier: Q4JDL3-9) [UniParc]FASTAAdd to Basket

Also known as: Variant 18

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     165-185: ALELKNLPGEFNSGNQPSNRE → MIQHAFLLEKARTTSMLVILE
     186-420: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:104
Mass (Da):11,999
Checksum:iDD927F235474DDB6
GO
Isoform 10 (identifier: Q4JDL3-10) [UniParc]FASTAAdd to Basket

Also known as: Variant 8

The sequence of this isoform differs from the canonical sequence as follows:
     165-378: Missing.

Show »
Length:206
Mass (Da):23,869
Checksum:i3AE7C577FAE313F6
GO
Isoform 11 (identifier: Q4JDL3-11) [UniParc]FASTAAdd to Basket

Also known as: Variant 2

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
     165-306: Missing.

Show »
Length:269
Mass (Da):30,648
Checksum:i26C149800AABD0C2
GO
Isoform 12 (identifier: Q4JDL3-12) [UniParc]FASTAAdd to Basket

Also known as: Variant 11

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSK → MGTTCLHLGTLEQSL
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.

Show »
Length:198
Mass (Da):22,581
Checksum:i3955399CCEBDEF4E
GO
Isoform 13 (identifier: Q4JDL3-13) [UniParc]FASTAAdd to Basket

Also known as: Variant 9

The sequence of this isoform differs from the canonical sequence as follows:
     114-145: DTRKIVSEGELDQLAQIRPLIFNFHEQTAIKD → VQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     146-420: Missing.

Show »
Length:145
Mass (Da):16,414
Checksum:iCE6E89C11FA531C9
GO
Isoform 14 (identifier: Q4JDL3-14) [UniParc]FASTAAdd to Basket

Also known as: Variant 14

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.

Show »
Length:145
Mass (Da):16,643
Checksum:iD800415BBA550F7D
GO
Isoform 15 (identifier: Q4JDL3-15) [UniParc]FASTAAdd to Basket

Also known as: Variant 5

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
     114-145: DTRKIVSEGELDQLAQIRPLIFNFHEQTAIKD → VQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     146-420: Missing.

Show »
Length:136
Mass (Da):15,384
Checksum:iA29B5EC8F4DE0E89
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 192192Missing in isoform 6. VSP_027063Add
BLAST
Alternative sequencei1 – 8181Missing in isoform 4, isoform 5, isoform 9 and isoform 14. VSP_027064Add
BLAST
Alternative sequencei1 – 4343MSSPR…TPRSK → MGTTCLHLGTLEQSL in isoform 3 and isoform 12. VSP_027065Add
BLAST
Alternative sequencei1 – 1111MSSPRDFRAEP → MI in isoform 2, isoform 8, isoform 11 and isoform 15. VSP_027066Add
BLAST
Alternative sequencei114 – 14532DTRKI…TAIKD → VQHHGYSGPNERTTFWHGSN EGAVSLLLRYCA in isoform 13 and isoform 15. VSP_027067Add
BLAST
Alternative sequencei146 – 420275Missing in isoform 13 and isoform 15. VSP_027068Add
BLAST
Alternative sequencei165 – 378214Missing in isoform 10. VSP_027069Add
BLAST
Alternative sequencei165 – 306142Missing in isoform 5 and isoform 11. VSP_027070Add
BLAST
Alternative sequencei165 – 18521ALELK…PSNRE → MIQHAFLLEKARTTSMLVIL E in isoform 9. VSP_038003Add
BLAST
Alternative sequencei186 – 420235Missing in isoform 9. VSP_038004Add
BLAST
Alternative sequencei193 – 1953LPY → MID in isoform 6. VSP_027071
Alternative sequencei195 – 22632YDSTR…EYFYI → FQHHGYSGPNERTTFWHGSN EGAVSLLLRYCA in isoform 7, isoform 8, isoform 12 and isoform 14. VSP_027072Add
BLAST
Alternative sequencei227 – 420194Missing in isoform 7, isoform 8, isoform 12 and isoform 14. VSP_027073Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY704141 mRNA. Translation: AAW28780.1.
AY704142 mRNA. Translation: AAW28781.1.
AY704143 mRNA. Translation: AAW28782.1.
AY704144 mRNA. Translation: AAW28783.1.
AY704145 mRNA. Translation: AAW28784.1.
AY704146 mRNA. Translation: AAW28785.1.
AY704147 mRNA. Translation: AAW28786.1.
AY704148 mRNA. Translation: AAW28787.1.
AY704149 mRNA. Translation: AAW28788.1.
AY704150 mRNA. Translation: AAW28789.1.
AY704151 mRNA. Translation: AAW28790.1.
AY704152 mRNA. Translation: AAW28791.1.
AY704153 mRNA. Translation: AAW28792.1.
AY704154 mRNA. Translation: AAW28793.1.
AY704158 mRNA. Translation: AAW28797.1. Sequence problems.
AY753191 mRNA. Translation: AAW88572.1.
AL450334, AL672108 Genomic DNA. Translation: CAI15685.1.
AL358791, BX005072 Genomic DNA. Translation: CAI14088.1.
AL358791, BX005072 Genomic DNA. Translation: CAI14090.1.
AL672108, AL450334 Genomic DNA. Translation: CAI12200.1.
BX005072, AL358791 Genomic DNA. Translation: CAI23640.1.
BX005072, AL358791 Genomic DNA. Translation: CAI23642.1.
BC093750 mRNA. Translation: AAH93750.1.
BC113473 mRNA. Translation: AAI13474.1.
BC143394 mRNA. Translation: AAI43395.1.
BC171725 mRNA. Translation: AAI71725.1.
CCDSiCCDS41512.1. [Q4JDL3-6]
CCDS41513.1. [Q4JDL3-2]
CCDS41514.1. [Q4JDL3-1]
CCDS41515.1. [Q4JDL3-4]
CCDS41516.1. [Q4JDL3-14]
CCDS53533.1. [Q4JDL3-15]
CCDS53534.1. [Q4JDL3-11]
CCDS53535.1. [Q4JDL3-8]
CCDS7221.1. [Q4JDL3-7]
RefSeqiNP_001035816.1. NM_001042357.3. [Q4JDL3-1]
NP_001035817.1. NM_001042358.3. [Q4JDL3-2]
NP_001035818.1. NM_001042359.2. [Q4JDL3-11]
NP_001035819.1. NM_001042360.2. [Q4JDL3-6]
NP_001035820.1. NM_001042361.3. [Q4JDL3-8]
NP_001035821.1. NM_001042362.2. [Q4JDL3-15]
NP_001035822.1. NM_001042363.3. [Q4JDL3-4]
NP_001035823.1. NM_001042364.3. [Q4JDL3-14]
NP_056420.3. NM_015605.7. [Q4JDL3-7]
XP_005270372.1. XM_005270315.1. [Q4JDL3-4]
XP_005277709.1. XM_005277652.1. [Q4JDL3-4]
XP_006717817.1. XM_006717754.1. [Q4JDL3-10]
XP_006717818.1. XM_006717755.1. [Q4JDL3-13]
UniGeneiHs.440733.
Hs.499552.

Genome annotation databases

EnsembliENST00000331650; ENSP00000331832; ENSG00000183675. [Q4JDL3-4]
ENST00000374218; ENSP00000363335; ENSG00000204179. [Q4JDL3-4]
ENST00000374233; ENSP00000363350; ENSG00000183675. [Q4JDL3-1]
ENST00000374240; ENSP00000363357; ENSG00000183675. [Q4JDL3-7]
ENST00000374339; ENSP00000363459; ENSG00000204179. [Q4JDL3-1]
ENST00000374346; ENSP00000363466; ENSG00000204179. [Q4JDL3-7]
ENST00000395660; ENSP00000379020; ENSG00000183675. [Q4JDL3-3]
ENST00000395661; ENSP00000379021; ENSG00000183675. [Q4JDL3-10]
ENST00000395662; ENSP00000379022; ENSG00000183675. [Q4JDL3-14]
ENST00000395668; ENSP00000379027; ENSG00000183675. [Q4JDL3-4]
ENST00000395674; ENSP00000379033; ENSG00000183675. [Q4JDL3-6]
ENST00000395721; ENSP00000379071; ENSG00000204179. [Q4JDL3-4]
ENST00000395722; ENSP00000379072; ENSG00000204179. [Q4JDL3-10]
ENST00000395725; ENSP00000379075; ENSG00000204179. [Q4JDL3-14]
ENST00000395727; ENSP00000379077; ENSG00000204179. [Q4JDL3-6]
ENST00000437863; ENSP00000403444; ENSG00000204179. [Q4JDL3-3]
ENST00000502254; ENSP00000421404; ENSG00000204179. [Q4JDL3-13]
ENST00000502266; ENSP00000424728; ENSG00000183675. [Q4JDL3-14]
ENST00000502705; ENSP00000420995; ENSG00000204179. [Q4JDL3-10]
ENST00000503851; ENSP00000427676; ENSG00000204179. [Q4JDL3-15]
ENST00000505814; ENSP00000426355; ENSG00000204179. [Q4JDL3-4]
ENST00000506080; ENSP00000421921; ENSG00000204179. [Q4JDL3-3]
ENST00000507417; ENSP00000425723; ENSG00000183675. [Q4JDL3-12]
ENST00000508602; ENSP00000424491; ENSG00000204179. [Q4JDL3-12]
ENST00000509230; ENSP00000421604; ENSG00000183675. [Q4JDL3-8]
ENST00000509599; ENSP00000425012; ENSG00000204179. [Q4JDL3-7]
ENST00000509631; ENSP00000424344; ENSG00000183675. [Q4JDL3-4]
ENST00000509753; ENSP00000425285; ENSG00000183675. [Q4JDL3-3]
ENST00000509774; ENSP00000425362; ENSG00000204179. [Q4JDL3-8]
ENST00000509900; ENSP00000423819; ENSG00000204179. [Q4JDL3-14]
ENST00000510335; ENSP00000421453; ENSG00000204179. [Q4JDL3-9]
ENST00000510840; ENSP00000423545; ENSG00000183675. [Q4JDL3-10]
ENST00000511387; ENSP00000426298; ENSG00000183675. [Q4JDL3-15]
ENST00000511769; ENSP00000424283; ENSG00000204179. [Q4JDL3-2]
ENST00000512321; ENSP00000427588; ENSG00000183675. [Q4JDL3-13]
ENST00000512924; ENSP00000421999; ENSG00000183675. [Q4JDL3-5]
ENST00000513156; ENSP00000425912; ENSG00000204179. [Q4JDL3-11]
ENST00000513266; ENSP00000422839; ENSG00000204179. [Q4JDL3-5]
ENST00000513933; ENSP00000427171; ENSG00000183675. [Q4JDL3-9]
ENST00000514491; ENSP00000424942; ENSG00000183675. [Q4JDL3-2]
ENST00000514592; ENSP00000423839; ENSG00000183675. [Q4JDL3-11]
ENST00000515532; ENSP00000422953; ENSG00000183675. [Q4JDL3-7]
ENST00000577492; ENSP00000463630; ENSG00000264832. [Q4JDL3-3]
ENST00000578057; ENSP00000462327; ENSG00000264832. [Q4JDL3-8]
ENST00000578533; ENSP00000462801; ENSG00000264832. [Q4JDL3-10]
ENST00000578769; ENSP00000461946; ENSG00000264832. [Q4JDL3-11]
ENST00000579331; ENSP00000462511; ENSG00000264832. [Q4JDL3-7]
ENST00000580111; ENSP00000462277; ENSG00000264832. [Q4JDL3-12]
ENST00000580860; ENSP00000462373; ENSG00000264832. [Q4JDL3-10]
ENST00000581259; ENSP00000462053; ENSG00000264832. [Q4JDL3-13]
ENST00000581350; ENSP00000462400; ENSG00000264832. [Q4JDL3-14]
ENST00000581507; ENSP00000464379; ENSG00000264832. [Q4JDL3-14]
ENST00000582045; ENSP00000463987; ENSG00000264832. [Q4JDL3-15]
ENST00000582312; ENSP00000462983; ENSG00000264832. [Q4JDL3-2]
ENST00000582347; ENSP00000464514; ENSG00000264832. [Q4JDL3-9]
ENST00000583073; ENSP00000463133; ENSG00000264832. [Q4JDL3-7]
ENST00000583297; ENSP00000462849; ENSG00000264832. [Q4JDL3-1]
ENST00000583680; ENSP00000463932; ENSG00000264832. [Q4JDL3-5]
ENST00000583723; ENSP00000464692; ENSG00000264832. [Q4JDL3-4]
ENST00000583736; ENSP00000461975; ENSG00000264832. [Q4JDL3-3]
ENST00000584081; ENSP00000464175; ENSG00000264832. [Q4JDL3-4]
ENST00000584823; ENSP00000463290; ENSG00000264832. [Q4JDL3-6]
ENST00000584849; ENSP00000463765; ENSG00000264832. [Q4JDL3-4]
GeneIDi26095.
KEGGihsa:26095.
hsa:653129.
UCSCiuc001jcz.1. human. [Q4JDL3-12]
uc001jdb.1. human. [Q4JDL3-13]
uc001jdc.1. human. [Q4JDL3-1]
uc001jdd.1. human. [Q4JDL3-2]
uc001jde.1. human. [Q4JDL3-6]
uc001jdf.1. human. [Q4JDL3-3]
uc001jdh.1. human. [Q4JDL3-7]
uc001jdi.1. human. [Q4JDL3-14]
uc001jdj.1. human. [Q4JDL3-5]
uc001jdm.1. human. [Q4JDL3-8]
uc001jdn.1. human. [Q4JDL3-11]
uc001jdo.1. human. [Q4JDL3-15]
uc009xmx.1. human. [Q4JDL3-10]

Polymorphism databases

DMDMi121944218.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY704141 mRNA. Translation: AAW28780.1 .
AY704142 mRNA. Translation: AAW28781.1 .
AY704143 mRNA. Translation: AAW28782.1 .
AY704144 mRNA. Translation: AAW28783.1 .
AY704145 mRNA. Translation: AAW28784.1 .
AY704146 mRNA. Translation: AAW28785.1 .
AY704147 mRNA. Translation: AAW28786.1 .
AY704148 mRNA. Translation: AAW28787.1 .
AY704149 mRNA. Translation: AAW28788.1 .
AY704150 mRNA. Translation: AAW28789.1 .
AY704151 mRNA. Translation: AAW28790.1 .
AY704152 mRNA. Translation: AAW28791.1 .
AY704153 mRNA. Translation: AAW28792.1 .
AY704154 mRNA. Translation: AAW28793.1 .
AY704158 mRNA. Translation: AAW28797.1 . Sequence problems.
AY753191 mRNA. Translation: AAW88572.1 .
AL450334 , AL672108 Genomic DNA. Translation: CAI15685.1 .
AL358791 , BX005072 Genomic DNA. Translation: CAI14088.1 .
AL358791 , BX005072 Genomic DNA. Translation: CAI14090.1 .
AL672108 , AL450334 Genomic DNA. Translation: CAI12200.1 .
BX005072 , AL358791 Genomic DNA. Translation: CAI23640.1 .
BX005072 , AL358791 Genomic DNA. Translation: CAI23642.1 .
BC093750 mRNA. Translation: AAH93750.1 .
BC113473 mRNA. Translation: AAI13474.1 .
BC143394 mRNA. Translation: AAI43395.1 .
BC171725 mRNA. Translation: AAI71725.1 .
CCDSi CCDS41512.1. [Q4JDL3-6 ]
CCDS41513.1. [Q4JDL3-2 ]
CCDS41514.1. [Q4JDL3-1 ]
CCDS41515.1. [Q4JDL3-4 ]
CCDS41516.1. [Q4JDL3-14 ]
CCDS53533.1. [Q4JDL3-15 ]
CCDS53534.1. [Q4JDL3-11 ]
CCDS53535.1. [Q4JDL3-8 ]
CCDS7221.1. [Q4JDL3-7 ]
RefSeqi NP_001035816.1. NM_001042357.3. [Q4JDL3-1 ]
NP_001035817.1. NM_001042358.3. [Q4JDL3-2 ]
NP_001035818.1. NM_001042359.2. [Q4JDL3-11 ]
NP_001035819.1. NM_001042360.2. [Q4JDL3-6 ]
NP_001035820.1. NM_001042361.3. [Q4JDL3-8 ]
NP_001035821.1. NM_001042362.2. [Q4JDL3-15 ]
NP_001035822.1. NM_001042363.3. [Q4JDL3-4 ]
NP_001035823.1. NM_001042364.3. [Q4JDL3-14 ]
NP_056420.3. NM_015605.7. [Q4JDL3-7 ]
XP_005270372.1. XM_005270315.1. [Q4JDL3-4 ]
XP_005277709.1. XM_005277652.1. [Q4JDL3-4 ]
XP_006717817.1. XM_006717754.1. [Q4JDL3-10 ]
XP_006717818.1. XM_006717755.1. [Q4JDL3-13 ]
UniGenei Hs.440733.
Hs.499552.

3D structure databases

ProteinModelPortali Q4JDL3.
SMRi Q4JDL3. Positions 142-416.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 575548. 1 interaction.

PTM databases

PhosphoSitei Q4JDL3.

Polymorphism databases

DMDMi 121944218.

Proteomic databases

PaxDbi Q4JDL3.
PRIDEi Q4JDL3.

Protocols and materials databases

DNASUi 26095.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000331650 ; ENSP00000331832 ; ENSG00000183675 . [Q4JDL3-4 ]
ENST00000374218 ; ENSP00000363335 ; ENSG00000204179 . [Q4JDL3-4 ]
ENST00000374233 ; ENSP00000363350 ; ENSG00000183675 . [Q4JDL3-1 ]
ENST00000374240 ; ENSP00000363357 ; ENSG00000183675 . [Q4JDL3-7 ]
ENST00000374339 ; ENSP00000363459 ; ENSG00000204179 . [Q4JDL3-1 ]
ENST00000374346 ; ENSP00000363466 ; ENSG00000204179 . [Q4JDL3-7 ]
ENST00000395660 ; ENSP00000379020 ; ENSG00000183675 . [Q4JDL3-3 ]
ENST00000395661 ; ENSP00000379021 ; ENSG00000183675 . [Q4JDL3-10 ]
ENST00000395662 ; ENSP00000379022 ; ENSG00000183675 . [Q4JDL3-14 ]
ENST00000395668 ; ENSP00000379027 ; ENSG00000183675 . [Q4JDL3-4 ]
ENST00000395674 ; ENSP00000379033 ; ENSG00000183675 . [Q4JDL3-6 ]
ENST00000395721 ; ENSP00000379071 ; ENSG00000204179 . [Q4JDL3-4 ]
ENST00000395722 ; ENSP00000379072 ; ENSG00000204179 . [Q4JDL3-10 ]
ENST00000395725 ; ENSP00000379075 ; ENSG00000204179 . [Q4JDL3-14 ]
ENST00000395727 ; ENSP00000379077 ; ENSG00000204179 . [Q4JDL3-6 ]
ENST00000437863 ; ENSP00000403444 ; ENSG00000204179 . [Q4JDL3-3 ]
ENST00000502254 ; ENSP00000421404 ; ENSG00000204179 . [Q4JDL3-13 ]
ENST00000502266 ; ENSP00000424728 ; ENSG00000183675 . [Q4JDL3-14 ]
ENST00000502705 ; ENSP00000420995 ; ENSG00000204179 . [Q4JDL3-10 ]
ENST00000503851 ; ENSP00000427676 ; ENSG00000204179 . [Q4JDL3-15 ]
ENST00000505814 ; ENSP00000426355 ; ENSG00000204179 . [Q4JDL3-4 ]
ENST00000506080 ; ENSP00000421921 ; ENSG00000204179 . [Q4JDL3-3 ]
ENST00000507417 ; ENSP00000425723 ; ENSG00000183675 . [Q4JDL3-12 ]
ENST00000508602 ; ENSP00000424491 ; ENSG00000204179 . [Q4JDL3-12 ]
ENST00000509230 ; ENSP00000421604 ; ENSG00000183675 . [Q4JDL3-8 ]
ENST00000509599 ; ENSP00000425012 ; ENSG00000204179 . [Q4JDL3-7 ]
ENST00000509631 ; ENSP00000424344 ; ENSG00000183675 . [Q4JDL3-4 ]
ENST00000509753 ; ENSP00000425285 ; ENSG00000183675 . [Q4JDL3-3 ]
ENST00000509774 ; ENSP00000425362 ; ENSG00000204179 . [Q4JDL3-8 ]
ENST00000509900 ; ENSP00000423819 ; ENSG00000204179 . [Q4JDL3-14 ]
ENST00000510335 ; ENSP00000421453 ; ENSG00000204179 . [Q4JDL3-9 ]
ENST00000510840 ; ENSP00000423545 ; ENSG00000183675 . [Q4JDL3-10 ]
ENST00000511387 ; ENSP00000426298 ; ENSG00000183675 . [Q4JDL3-15 ]
ENST00000511769 ; ENSP00000424283 ; ENSG00000204179 . [Q4JDL3-2 ]
ENST00000512321 ; ENSP00000427588 ; ENSG00000183675 . [Q4JDL3-13 ]
ENST00000512924 ; ENSP00000421999 ; ENSG00000183675 . [Q4JDL3-5 ]
ENST00000513156 ; ENSP00000425912 ; ENSG00000204179 . [Q4JDL3-11 ]
ENST00000513266 ; ENSP00000422839 ; ENSG00000204179 . [Q4JDL3-5 ]
ENST00000513933 ; ENSP00000427171 ; ENSG00000183675 . [Q4JDL3-9 ]
ENST00000514491 ; ENSP00000424942 ; ENSG00000183675 . [Q4JDL3-2 ]
ENST00000514592 ; ENSP00000423839 ; ENSG00000183675 . [Q4JDL3-11 ]
ENST00000515532 ; ENSP00000422953 ; ENSG00000183675 . [Q4JDL3-7 ]
ENST00000577492 ; ENSP00000463630 ; ENSG00000264832 . [Q4JDL3-3 ]
ENST00000578057 ; ENSP00000462327 ; ENSG00000264832 . [Q4JDL3-8 ]
ENST00000578533 ; ENSP00000462801 ; ENSG00000264832 . [Q4JDL3-10 ]
ENST00000578769 ; ENSP00000461946 ; ENSG00000264832 . [Q4JDL3-11 ]
ENST00000579331 ; ENSP00000462511 ; ENSG00000264832 . [Q4JDL3-7 ]
ENST00000580111 ; ENSP00000462277 ; ENSG00000264832 . [Q4JDL3-12 ]
ENST00000580860 ; ENSP00000462373 ; ENSG00000264832 . [Q4JDL3-10 ]
ENST00000581259 ; ENSP00000462053 ; ENSG00000264832 . [Q4JDL3-13 ]
ENST00000581350 ; ENSP00000462400 ; ENSG00000264832 . [Q4JDL3-14 ]
ENST00000581507 ; ENSP00000464379 ; ENSG00000264832 . [Q4JDL3-14 ]
ENST00000582045 ; ENSP00000463987 ; ENSG00000264832 . [Q4JDL3-15 ]
ENST00000582312 ; ENSP00000462983 ; ENSG00000264832 . [Q4JDL3-2 ]
ENST00000582347 ; ENSP00000464514 ; ENSG00000264832 . [Q4JDL3-9 ]
ENST00000583073 ; ENSP00000463133 ; ENSG00000264832 . [Q4JDL3-7 ]
ENST00000583297 ; ENSP00000462849 ; ENSG00000264832 . [Q4JDL3-1 ]
ENST00000583680 ; ENSP00000463932 ; ENSG00000264832 . [Q4JDL3-5 ]
ENST00000583723 ; ENSP00000464692 ; ENSG00000264832 . [Q4JDL3-4 ]
ENST00000583736 ; ENSP00000461975 ; ENSG00000264832 . [Q4JDL3-3 ]
ENST00000584081 ; ENSP00000464175 ; ENSG00000264832 . [Q4JDL3-4 ]
ENST00000584823 ; ENSP00000463290 ; ENSG00000264832 . [Q4JDL3-6 ]
ENST00000584849 ; ENSP00000463765 ; ENSG00000264832 . [Q4JDL3-4 ]
GeneIDi 26095.
KEGGi hsa:26095.
hsa:653129.
UCSCi uc001jcz.1. human. [Q4JDL3-12 ]
uc001jdb.1. human. [Q4JDL3-13 ]
uc001jdc.1. human. [Q4JDL3-1 ]
uc001jdd.1. human. [Q4JDL3-2 ]
uc001jde.1. human. [Q4JDL3-6 ]
uc001jdf.1. human. [Q4JDL3-3 ]
uc001jdh.1. human. [Q4JDL3-7 ]
uc001jdi.1. human. [Q4JDL3-14 ]
uc001jdj.1. human. [Q4JDL3-5 ]
uc001jdm.1. human. [Q4JDL3-8 ]
uc001jdn.1. human. [Q4JDL3-11 ]
uc001jdo.1. human. [Q4JDL3-15 ]
uc009xmx.1. human. [Q4JDL3-10 ]

Organism-specific databases

CTDi 26095.
GeneCardsi GC10M046550.
GC10M048738.
HGNCi HGNC:23422. PTPN20A.
HGNC:23423. PTPN20B.
HPAi HPA043337.
HPA046896.
HPA047055.
HPA048310.
MIMi 610630. gene.
610631. gene.
neXtProti NX_Q4JDL3.
PharmGKBi PA134904835.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5599.
HOVERGENi HBG095763.
InParanoidi Q4JDL3.
KOi K18039.
OMAi FCAIVKN.
PhylomeDBi Q4JDL3.
TreeFami TF315573.

Miscellaneous databases

NextBioi 48049.
PROi Q4JDL3.
SOURCEi Search...

Gene expression databases

Bgeei Q4JDL3.
CleanExi HS_PTPN20A.
Genevestigatori Q4JDL3.

Family and domain databases

Gene3Di 3.90.190.10. 1 hit.
InterProi IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view ]
Pfami PF00102. Y_phosphatase. 1 hit.
[Graphical view ]
PRINTSi PR00700. PRTYPHPHTASE.
SMARTi SM00194. PTPc. 1 hit.
[Graphical view ]
SUPFAMi SSF52799. SSF52799. 1 hit.
PROSITEi PS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50055. TYR_PHOSPHATASE_PTP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Protein tyrosine phosphatase hPTPN20a is targeted to sites of actin polymerization."
    Fodero-Tavoletti M.T., Hardy M.P., Cornell B., Katsis F., Sadek C.M., Mitchell C.A., Kemp B.E., Tiganis T.
    Biochem. J. 389:343-354(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14 AND 15), ENZYME ACTIVITY, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  2. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
    Tissue: Heart and Lung.

Entry informationi

Entry nameiPTN20_HUMAN
AccessioniPrimary (citable) accession number: Q4JDL3
Secondary accession number(s): A6NNH8
, B7ZKV3, Q4JDG6, Q4JDK1, Q4JDK5, Q4JDK6, Q4JDK8, Q4JDK9, Q4JDL0, Q4JDL1, Q4JDL4, Q4JDL5, Q4JDL6, Q4JDL7, Q4JDL8, Q5RJ33, Q5T1G3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: August 2, 2005
Last modified: September 3, 2014
This is version 79 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi