Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q4JDL3

- PTN20_HUMAN

UniProt

Q4JDL3 - PTN20_HUMAN

Protein

Tyrosine-protein phosphatase non-receptor type 20

Gene

PTPN20A

more
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 80 (01 Oct 2014)
      Sequence version 1 (02 Aug 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Tyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates.

    Catalytic activityi

    Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.1 PublicationPROSITE-ProRule annotation

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei323 – 3231SubstrateBy similarity
    Active sitei353 – 3531Phosphocysteine intermediatePROSITE-ProRule annotation
    Binding sitei397 – 3971SubstrateBy similarity

    GO - Molecular functioni

    1. protein tyrosine phosphatase activity Source: UniProtKB-EC

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tyrosine-protein phosphatase non-receptor type 20 (EC:3.1.3.48)
    Short name:
    hPTPN20
    Gene namesi
    Name:PTPN20A
    AND
    Name:PTPN20B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:23422. PTPN20A.
    HGNC:23423. PTPN20B.

    Subcellular locationi

    Nucleus 1 Publication. Cytoplasm 1 Publication. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome 1 Publication
    Note: Colocalizes with the microtubule-organizing center and intracellular membrane compartments.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. microtubule Source: UniProtKB-KW
    3. microtubule organizing center Source: UniProtKB-SubCell
    4. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton, Microtubule, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134904835.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 420420Tyrosine-protein phosphatase non-receptor type 20PRO_0000295755Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei120 – 1201PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ4JDL3.
    PRIDEiQ4JDL3.

    PTM databases

    PhosphoSiteiQ4JDL3.

    Expressioni

    Tissue specificityi

    Present in many cell lines (at protein level). Widely expressed.1 Publication

    Gene expression databases

    BgeeiQ4JDL3.
    CleanExiHS_PTPN20A.
    GenevestigatoriQ4JDL3.

    Organism-specific databases

    HPAiHPA043337.
    HPA046896.
    HPA047055.
    HPA048310.

    Interactioni

    Protein-protein interaction databases

    BioGridi575548. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ4JDL3.
    SMRiQ4JDL3. Positions 142-416.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini159 – 412254Tyrosine-protein phosphatasePROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni353 – 3597Substrate bindingBy similarity

    Sequence similaritiesi

    Contains 1 tyrosine-protein phosphatase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG5599.
    HOVERGENiHBG095763.
    InParanoidiQ4JDL3.
    KOiK18039.
    OMAiFCAIVKN.
    PhylomeDBiQ4JDL3.
    TreeFamiTF315573.

    Family and domain databases

    Gene3Di3.90.190.10. 1 hit.
    InterProiIPR029021. Prot-tyrosine_phosphatase-like.
    IPR000387. Tyr/Dual-sp_Pase.
    IPR016130. Tyr_Pase_AS.
    IPR000242. Tyr_Pase_rcpt/non-rcpt.
    [Graphical view]
    PfamiPF00102. Y_phosphatase. 1 hit.
    [Graphical view]
    PRINTSiPR00700. PRTYPHPHTASE.
    SMARTiSM00194. PTPc. 1 hit.
    [Graphical view]
    SUPFAMiSSF52799. SSF52799. 1 hit.
    PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
    PS50056. TYR_PHOSPHATASE_2. 1 hit.
    PS50055. TYR_PHOSPHATASE_PTP. 1 hit.
    [Graphical view]

    Sequences (15)i

    Sequence statusi: Complete.

    This entry describes 15 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q4JDL3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSSPRDFRAE PVNDYEGNDS EAEDLNFRET LPSSSQENTP RSKVFENKVN    50
    SEKVKLSLRN FPHNDYEDVF EEPSESGSDP SMWTARGPFR RDRWSSEDEE 100
    AAGPSQALSP LLSDTRKIVS EGELDQLAQI RPLIFNFHEQ TAIKDCLKIL 150
    EEKTAAYDIM QEFMALELKN LPGEFNSGNQ PSNREKNRYR DILPYDSTRV 200
    PLGKSKDYIN ASYIRIVNCG EEYFYIATQG PLLSTIDDFW QMVLENNSNV 250
    IAMITREIEG GIIKCYHYWP ISLKKPLELK HFRVFLENYQ ILQYFIIRMF 300
    QVVEKSTGTS HSVKQLQFTK WPDHGTPASA DSFIKYIRYA RKSHLTGPMV 350
    VHCSAGIGRT GVFLCVDVVF CAIVKNCSFN IMDIVAQMRE QRSGMVQTKE 400
    QYHFCYDIVL EVLRKLLTLD 420
    Length:420
    Mass (Da):48,423
    Last modified:August 2, 2005 - v1
    Checksum:iF3A1C8041ACB710E
    GO
    Isoform 2 (identifier: Q4JDL3-2) [UniParc]FASTAAdd to Basket

    Also known as: Variant 1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MSSPRDFRAEP → MI

    Show »
    Length:411
    Mass (Da):47,393
    Checksum:i84315BC1463CF896
    GO
    Isoform 3 (identifier: Q4JDL3-3) [UniParc]FASTAAdd to Basket

    Also known as: Variant 10

    The sequence of this isoform differs from the canonical sequence as follows:
         1-43: MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSK → MGTTCLHLGTLEQSL

    Show »
    Length:392
    Mass (Da):45,123
    Checksum:i0117231EAC24C57B
    GO
    Isoform 4 (identifier: Q4JDL3-4) [UniParc]FASTAAdd to Basket

    Also known as: Variant 12

    The sequence of this isoform differs from the canonical sequence as follows:
         1-81: Missing.

    Show »
    Length:339
    Mass (Da):39,184
    Checksum:i33F1B10881A748C5
    GO
    Isoform 5 (identifier: Q4JDL3-5) [UniParc]FASTAAdd to Basket

    Also known as: Variant 13

    The sequence of this isoform differs from the canonical sequence as follows:
         1-81: Missing.
         165-306: Missing.

    Show »
    Length:197
    Mass (Da):22,439
    Checksum:i75CC97D2E52F5EE4
    GO
    Isoform 6 (identifier: Q4JDL3-6) [UniParc]FASTAAdd to Basket

    Also known as: Variant 3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-192: Missing.
         193-195: LPY → MID

    Show »
    Length:228
    Mass (Da):26,374
    Checksum:i7A416A64EF1E9D8C
    GO
    Isoform 7 (identifier: Q4JDL3-7) [UniParc]FASTAAdd to Basket

    Also known as: Variant 7

    The sequence of this isoform differs from the canonical sequence as follows:
         195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
         227-420: Missing.

    Show »
    Length:226
    Mass (Da):25,881
    Checksum:i7E024F34E1952E10
    GO
    Isoform 8 (identifier: Q4JDL3-8) [UniParc]FASTAAdd to Basket

    Also known as: Variant 4

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MSSPRDFRAEP → MI
         195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
         227-420: Missing.

    Show »
    Length:217
    Mass (Da):24,851
    Checksum:iC4F0BC493F07E554
    GO
    Isoform 9 (identifier: Q4JDL3-9) [UniParc]FASTAAdd to Basket

    Also known as: Variant 18

    The sequence of this isoform differs from the canonical sequence as follows:
         1-81: Missing.
         165-185: ALELKNLPGEFNSGNQPSNRE → MIQHAFLLEKARTTSMLVILE
         186-420: Missing.

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:104
    Mass (Da):11,999
    Checksum:iDD927F235474DDB6
    GO
    Isoform 10 (identifier: Q4JDL3-10) [UniParc]FASTAAdd to Basket

    Also known as: Variant 8

    The sequence of this isoform differs from the canonical sequence as follows:
         165-378: Missing.

    Show »
    Length:206
    Mass (Da):23,869
    Checksum:i3AE7C577FAE313F6
    GO
    Isoform 11 (identifier: Q4JDL3-11) [UniParc]FASTAAdd to Basket

    Also known as: Variant 2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MSSPRDFRAEP → MI
         165-306: Missing.

    Show »
    Length:269
    Mass (Da):30,648
    Checksum:i26C149800AABD0C2
    GO
    Isoform 12 (identifier: Q4JDL3-12) [UniParc]FASTAAdd to Basket

    Also known as: Variant 11

    The sequence of this isoform differs from the canonical sequence as follows:
         1-43: MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSK → MGTTCLHLGTLEQSL
         195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
         227-420: Missing.

    Show »
    Length:198
    Mass (Da):22,581
    Checksum:i3955399CCEBDEF4E
    GO
    Isoform 13 (identifier: Q4JDL3-13) [UniParc]FASTAAdd to Basket

    Also known as: Variant 9

    The sequence of this isoform differs from the canonical sequence as follows:
         114-145: DTRKIVSEGELDQLAQIRPLIFNFHEQTAIKD → VQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
         146-420: Missing.

    Show »
    Length:145
    Mass (Da):16,414
    Checksum:iCE6E89C11FA531C9
    GO
    Isoform 14 (identifier: Q4JDL3-14) [UniParc]FASTAAdd to Basket

    Also known as: Variant 14

    The sequence of this isoform differs from the canonical sequence as follows:
         1-81: Missing.
         195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
         227-420: Missing.

    Show »
    Length:145
    Mass (Da):16,643
    Checksum:iD800415BBA550F7D
    GO
    Isoform 15 (identifier: Q4JDL3-15) [UniParc]FASTAAdd to Basket

    Also known as: Variant 5

    The sequence of this isoform differs from the canonical sequence as follows:
         1-11: MSSPRDFRAEP → MI
         114-145: DTRKIVSEGELDQLAQIRPLIFNFHEQTAIKD → VQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
         146-420: Missing.

    Show »
    Length:136
    Mass (Da):15,384
    Checksum:iA29B5EC8F4DE0E89
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 192192Missing in isoform 6. 1 PublicationVSP_027063Add
    BLAST
    Alternative sequencei1 – 8181Missing in isoform 4, isoform 5, isoform 9 and isoform 14. 1 PublicationVSP_027064Add
    BLAST
    Alternative sequencei1 – 4343MSSPR…TPRSK → MGTTCLHLGTLEQSL in isoform 3 and isoform 12. 1 PublicationVSP_027065Add
    BLAST
    Alternative sequencei1 – 1111MSSPRDFRAEP → MI in isoform 2, isoform 8, isoform 11 and isoform 15. 1 PublicationVSP_027066Add
    BLAST
    Alternative sequencei114 – 14532DTRKI…TAIKD → VQHHGYSGPNERTTFWHGSN EGAVSLLLRYCA in isoform 13 and isoform 15. 1 PublicationVSP_027067Add
    BLAST
    Alternative sequencei146 – 420275Missing in isoform 13 and isoform 15. 1 PublicationVSP_027068Add
    BLAST
    Alternative sequencei165 – 378214Missing in isoform 10. 1 PublicationVSP_027069Add
    BLAST
    Alternative sequencei165 – 306142Missing in isoform 5 and isoform 11. 1 PublicationVSP_027070Add
    BLAST
    Alternative sequencei165 – 18521ALELK…PSNRE → MIQHAFLLEKARTTSMLVIL E in isoform 9. 1 PublicationVSP_038003Add
    BLAST
    Alternative sequencei186 – 420235Missing in isoform 9. 1 PublicationVSP_038004Add
    BLAST
    Alternative sequencei193 – 1953LPY → MID in isoform 6. 1 PublicationVSP_027071
    Alternative sequencei195 – 22632YDSTR…EYFYI → FQHHGYSGPNERTTFWHGSN EGAVSLLLRYCA in isoform 7, isoform 8, isoform 12 and isoform 14. 2 PublicationsVSP_027072Add
    BLAST
    Alternative sequencei227 – 420194Missing in isoform 7, isoform 8, isoform 12 and isoform 14. 2 PublicationsVSP_027073Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY704141 mRNA. Translation: AAW28780.1.
    AY704142 mRNA. Translation: AAW28781.1.
    AY704143 mRNA. Translation: AAW28782.1.
    AY704144 mRNA. Translation: AAW28783.1.
    AY704145 mRNA. Translation: AAW28784.1.
    AY704146 mRNA. Translation: AAW28785.1.
    AY704147 mRNA. Translation: AAW28786.1.
    AY704148 mRNA. Translation: AAW28787.1.
    AY704149 mRNA. Translation: AAW28788.1.
    AY704150 mRNA. Translation: AAW28789.1.
    AY704151 mRNA. Translation: AAW28790.1.
    AY704152 mRNA. Translation: AAW28791.1.
    AY704153 mRNA. Translation: AAW28792.1.
    AY704154 mRNA. Translation: AAW28793.1.
    AY704158 mRNA. Translation: AAW28797.1. Sequence problems.
    AY753191 mRNA. Translation: AAW88572.1.
    AL450334, AL672108 Genomic DNA. Translation: CAI15685.1.
    AL358791, BX005072 Genomic DNA. Translation: CAI14088.1.
    AL358791, BX005072 Genomic DNA. Translation: CAI14090.1.
    AL672108, AL450334 Genomic DNA. Translation: CAI12200.1.
    BX005072, AL358791 Genomic DNA. Translation: CAI23640.1.
    BX005072, AL358791 Genomic DNA. Translation: CAI23642.1.
    BC093750 mRNA. Translation: AAH93750.1.
    BC113473 mRNA. Translation: AAI13474.1.
    BC143394 mRNA. Translation: AAI43395.1.
    BC171725 mRNA. Translation: AAI71725.1.
    CCDSiCCDS41512.1. [Q4JDL3-6]
    CCDS41513.1. [Q4JDL3-2]
    CCDS41514.1. [Q4JDL3-1]
    CCDS41515.1. [Q4JDL3-4]
    CCDS41516.1. [Q4JDL3-14]
    CCDS53533.1. [Q4JDL3-15]
    CCDS53534.1. [Q4JDL3-11]
    CCDS53535.1. [Q4JDL3-8]
    CCDS7221.1. [Q4JDL3-7]
    RefSeqiNP_001035816.1. NM_001042357.3. [Q4JDL3-1]
    NP_001035817.1. NM_001042358.3. [Q4JDL3-2]
    NP_001035818.1. NM_001042359.2. [Q4JDL3-11]
    NP_001035819.1. NM_001042360.2. [Q4JDL3-6]
    NP_001035820.1. NM_001042361.3. [Q4JDL3-8]
    NP_001035821.1. NM_001042362.2. [Q4JDL3-15]
    NP_001035822.1. NM_001042363.3. [Q4JDL3-4]
    NP_001035823.1. NM_001042364.3. [Q4JDL3-14]
    NP_056420.3. NM_015605.7. [Q4JDL3-7]
    XP_005270372.1. XM_005270315.1. [Q4JDL3-4]
    XP_005277709.1. XM_005277652.1. [Q4JDL3-4]
    XP_006717817.1. XM_006717754.1. [Q4JDL3-10]
    XP_006717818.1. XM_006717755.1. [Q4JDL3-13]
    UniGeneiHs.440733.
    Hs.499552.

    Genome annotation databases

    EnsembliENST00000374218; ENSP00000363335; ENSG00000204179. [Q4JDL3-4]
    ENST00000374339; ENSP00000363459; ENSG00000204179. [Q4JDL3-1]
    ENST00000374346; ENSP00000363466; ENSG00000204179. [Q4JDL3-7]
    ENST00000395721; ENSP00000379071; ENSG00000204179. [Q4JDL3-4]
    ENST00000395722; ENSP00000379072; ENSG00000204179. [Q4JDL3-10]
    ENST00000395725; ENSP00000379075; ENSG00000204179. [Q4JDL3-14]
    ENST00000395727; ENSP00000379077; ENSG00000204179. [Q4JDL3-6]
    ENST00000437863; ENSP00000403444; ENSG00000204179. [Q4JDL3-3]
    ENST00000502254; ENSP00000421404; ENSG00000204179. [Q4JDL3-13]
    ENST00000502705; ENSP00000420995; ENSG00000204179. [Q4JDL3-10]
    ENST00000503851; ENSP00000427676; ENSG00000204179. [Q4JDL3-15]
    ENST00000505814; ENSP00000426355; ENSG00000204179. [Q4JDL3-4]
    ENST00000506080; ENSP00000421921; ENSG00000204179. [Q4JDL3-3]
    ENST00000508602; ENSP00000424491; ENSG00000204179. [Q4JDL3-12]
    ENST00000509599; ENSP00000425012; ENSG00000204179. [Q4JDL3-7]
    ENST00000509774; ENSP00000425362; ENSG00000204179. [Q4JDL3-8]
    ENST00000509900; ENSP00000423819; ENSG00000204179. [Q4JDL3-14]
    ENST00000510335; ENSP00000421453; ENSG00000204179. [Q4JDL3-9]
    ENST00000511769; ENSP00000424283; ENSG00000204179. [Q4JDL3-2]
    ENST00000513156; ENSP00000425912; ENSG00000204179. [Q4JDL3-11]
    ENST00000513266; ENSP00000422839; ENSG00000204179. [Q4JDL3-5]
    GeneIDi26095.
    KEGGihsa:26095.
    hsa:653129.
    UCSCiuc001jcz.1. human. [Q4JDL3-12]
    uc001jdb.1. human. [Q4JDL3-13]
    uc001jdc.1. human. [Q4JDL3-1]
    uc001jdd.1. human. [Q4JDL3-2]
    uc001jde.1. human. [Q4JDL3-6]
    uc001jdf.1. human. [Q4JDL3-3]
    uc001jdh.1. human. [Q4JDL3-7]
    uc001jdi.1. human. [Q4JDL3-14]
    uc001jdj.1. human. [Q4JDL3-5]
    uc001jdm.1. human. [Q4JDL3-8]
    uc001jdn.1. human. [Q4JDL3-11]
    uc001jdo.1. human. [Q4JDL3-15]
    uc009xmx.1. human. [Q4JDL3-10]

    Polymorphism databases

    DMDMi121944218.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY704141 mRNA. Translation: AAW28780.1 .
    AY704142 mRNA. Translation: AAW28781.1 .
    AY704143 mRNA. Translation: AAW28782.1 .
    AY704144 mRNA. Translation: AAW28783.1 .
    AY704145 mRNA. Translation: AAW28784.1 .
    AY704146 mRNA. Translation: AAW28785.1 .
    AY704147 mRNA. Translation: AAW28786.1 .
    AY704148 mRNA. Translation: AAW28787.1 .
    AY704149 mRNA. Translation: AAW28788.1 .
    AY704150 mRNA. Translation: AAW28789.1 .
    AY704151 mRNA. Translation: AAW28790.1 .
    AY704152 mRNA. Translation: AAW28791.1 .
    AY704153 mRNA. Translation: AAW28792.1 .
    AY704154 mRNA. Translation: AAW28793.1 .
    AY704158 mRNA. Translation: AAW28797.1 . Sequence problems.
    AY753191 mRNA. Translation: AAW88572.1 .
    AL450334 , AL672108 Genomic DNA. Translation: CAI15685.1 .
    AL358791 , BX005072 Genomic DNA. Translation: CAI14088.1 .
    AL358791 , BX005072 Genomic DNA. Translation: CAI14090.1 .
    AL672108 , AL450334 Genomic DNA. Translation: CAI12200.1 .
    BX005072 , AL358791 Genomic DNA. Translation: CAI23640.1 .
    BX005072 , AL358791 Genomic DNA. Translation: CAI23642.1 .
    BC093750 mRNA. Translation: AAH93750.1 .
    BC113473 mRNA. Translation: AAI13474.1 .
    BC143394 mRNA. Translation: AAI43395.1 .
    BC171725 mRNA. Translation: AAI71725.1 .
    CCDSi CCDS41512.1. [Q4JDL3-6 ]
    CCDS41513.1. [Q4JDL3-2 ]
    CCDS41514.1. [Q4JDL3-1 ]
    CCDS41515.1. [Q4JDL3-4 ]
    CCDS41516.1. [Q4JDL3-14 ]
    CCDS53533.1. [Q4JDL3-15 ]
    CCDS53534.1. [Q4JDL3-11 ]
    CCDS53535.1. [Q4JDL3-8 ]
    CCDS7221.1. [Q4JDL3-7 ]
    RefSeqi NP_001035816.1. NM_001042357.3. [Q4JDL3-1 ]
    NP_001035817.1. NM_001042358.3. [Q4JDL3-2 ]
    NP_001035818.1. NM_001042359.2. [Q4JDL3-11 ]
    NP_001035819.1. NM_001042360.2. [Q4JDL3-6 ]
    NP_001035820.1. NM_001042361.3. [Q4JDL3-8 ]
    NP_001035821.1. NM_001042362.2. [Q4JDL3-15 ]
    NP_001035822.1. NM_001042363.3. [Q4JDL3-4 ]
    NP_001035823.1. NM_001042364.3. [Q4JDL3-14 ]
    NP_056420.3. NM_015605.7. [Q4JDL3-7 ]
    XP_005270372.1. XM_005270315.1. [Q4JDL3-4 ]
    XP_005277709.1. XM_005277652.1. [Q4JDL3-4 ]
    XP_006717817.1. XM_006717754.1. [Q4JDL3-10 ]
    XP_006717818.1. XM_006717755.1. [Q4JDL3-13 ]
    UniGenei Hs.440733.
    Hs.499552.

    3D structure databases

    ProteinModelPortali Q4JDL3.
    SMRi Q4JDL3. Positions 142-416.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 575548. 1 interaction.

    PTM databases

    PhosphoSitei Q4JDL3.

    Polymorphism databases

    DMDMi 121944218.

    Proteomic databases

    PaxDbi Q4JDL3.
    PRIDEi Q4JDL3.

    Protocols and materials databases

    DNASUi 26095.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000374218 ; ENSP00000363335 ; ENSG00000204179 . [Q4JDL3-4 ]
    ENST00000374339 ; ENSP00000363459 ; ENSG00000204179 . [Q4JDL3-1 ]
    ENST00000374346 ; ENSP00000363466 ; ENSG00000204179 . [Q4JDL3-7 ]
    ENST00000395721 ; ENSP00000379071 ; ENSG00000204179 . [Q4JDL3-4 ]
    ENST00000395722 ; ENSP00000379072 ; ENSG00000204179 . [Q4JDL3-10 ]
    ENST00000395725 ; ENSP00000379075 ; ENSG00000204179 . [Q4JDL3-14 ]
    ENST00000395727 ; ENSP00000379077 ; ENSG00000204179 . [Q4JDL3-6 ]
    ENST00000437863 ; ENSP00000403444 ; ENSG00000204179 . [Q4JDL3-3 ]
    ENST00000502254 ; ENSP00000421404 ; ENSG00000204179 . [Q4JDL3-13 ]
    ENST00000502705 ; ENSP00000420995 ; ENSG00000204179 . [Q4JDL3-10 ]
    ENST00000503851 ; ENSP00000427676 ; ENSG00000204179 . [Q4JDL3-15 ]
    ENST00000505814 ; ENSP00000426355 ; ENSG00000204179 . [Q4JDL3-4 ]
    ENST00000506080 ; ENSP00000421921 ; ENSG00000204179 . [Q4JDL3-3 ]
    ENST00000508602 ; ENSP00000424491 ; ENSG00000204179 . [Q4JDL3-12 ]
    ENST00000509599 ; ENSP00000425012 ; ENSG00000204179 . [Q4JDL3-7 ]
    ENST00000509774 ; ENSP00000425362 ; ENSG00000204179 . [Q4JDL3-8 ]
    ENST00000509900 ; ENSP00000423819 ; ENSG00000204179 . [Q4JDL3-14 ]
    ENST00000510335 ; ENSP00000421453 ; ENSG00000204179 . [Q4JDL3-9 ]
    ENST00000511769 ; ENSP00000424283 ; ENSG00000204179 . [Q4JDL3-2 ]
    ENST00000513156 ; ENSP00000425912 ; ENSG00000204179 . [Q4JDL3-11 ]
    ENST00000513266 ; ENSP00000422839 ; ENSG00000204179 . [Q4JDL3-5 ]
    GeneIDi 26095.
    KEGGi hsa:26095.
    hsa:653129.
    UCSCi uc001jcz.1. human. [Q4JDL3-12 ]
    uc001jdb.1. human. [Q4JDL3-13 ]
    uc001jdc.1. human. [Q4JDL3-1 ]
    uc001jdd.1. human. [Q4JDL3-2 ]
    uc001jde.1. human. [Q4JDL3-6 ]
    uc001jdf.1. human. [Q4JDL3-3 ]
    uc001jdh.1. human. [Q4JDL3-7 ]
    uc001jdi.1. human. [Q4JDL3-14 ]
    uc001jdj.1. human. [Q4JDL3-5 ]
    uc001jdm.1. human. [Q4JDL3-8 ]
    uc001jdn.1. human. [Q4JDL3-11 ]
    uc001jdo.1. human. [Q4JDL3-15 ]
    uc009xmx.1. human. [Q4JDL3-10 ]

    Organism-specific databases

    CTDi 26095.
    GeneCardsi GC10M046550.
    GC10M048738.
    HGNCi HGNC:23422. PTPN20A.
    HGNC:23423. PTPN20B.
    HPAi HPA043337.
    HPA046896.
    HPA047055.
    HPA048310.
    MIMi 610630. gene.
    610631. gene.
    neXtProti NX_Q4JDL3.
    PharmGKBi PA134904835.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5599.
    HOVERGENi HBG095763.
    InParanoidi Q4JDL3.
    KOi K18039.
    OMAi FCAIVKN.
    PhylomeDBi Q4JDL3.
    TreeFami TF315573.

    Miscellaneous databases

    NextBioi 48049.
    PROi Q4JDL3.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q4JDL3.
    CleanExi HS_PTPN20A.
    Genevestigatori Q4JDL3.

    Family and domain databases

    Gene3Di 3.90.190.10. 1 hit.
    InterProi IPR029021. Prot-tyrosine_phosphatase-like.
    IPR000387. Tyr/Dual-sp_Pase.
    IPR016130. Tyr_Pase_AS.
    IPR000242. Tyr_Pase_rcpt/non-rcpt.
    [Graphical view ]
    Pfami PF00102. Y_phosphatase. 1 hit.
    [Graphical view ]
    PRINTSi PR00700. PRTYPHPHTASE.
    SMARTi SM00194. PTPc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52799. SSF52799. 1 hit.
    PROSITEi PS00383. TYR_PHOSPHATASE_1. 1 hit.
    PS50056. TYR_PHOSPHATASE_2. 1 hit.
    PS50055. TYR_PHOSPHATASE_PTP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Protein tyrosine phosphatase hPTPN20a is targeted to sites of actin polymerization."
      Fodero-Tavoletti M.T., Hardy M.P., Cornell B., Katsis F., Sadek C.M., Mitchell C.A., Kemp B.E., Tiganis T.
      Biochem. J. 389:343-354(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14 AND 15), ENZYME ACTIVITY, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    2. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
      Tissue: Heart and Lung.

    Entry informationi

    Entry nameiPTN20_HUMAN
    AccessioniPrimary (citable) accession number: Q4JDL3
    Secondary accession number(s): A6NNH8
    , B7ZKV3, Q4JDG6, Q4JDK1, Q4JDK5, Q4JDK6, Q4JDK8, Q4JDK9, Q4JDL0, Q4JDL1, Q4JDL4, Q4JDL5, Q4JDL6, Q4JDL7, Q4JDL8, Q5RJ33, Q5T1G3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 24, 2007
    Last sequence update: August 2, 2005
    Last modified: October 1, 2014
    This is version 80 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3