Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q4JDL3 (PTN20_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 75. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tyrosine-protein phosphatase non-receptor type 20

Short name=hPTPN20
EC=3.1.3.48
Gene names
Name:PTPN20A
AND
Name:PTPN20B
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length420 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Tyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates.

Catalytic activity

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. Ref.1

Subcellular location

Nucleus. Cytoplasm. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Note: Colocalizes with the microtubule-organizing center and intracellular membrane compartments. Ref.1

Tissue specificity

Present in many cell lines (at protein level). Widely expressed. Ref.1

Sequence similarities

Belongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily.

Contains 1 tyrosine-protein phosphatase domain.

Sequence caution

The sequence AAW28797.1 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.

Ontologies

Keywords
   Cellular componentCytoplasm
Cytoskeleton
Microtubule
Nucleus
   Coding sequence diversityAlternative splicing
   Molecular functionHydrolase
Protein phosphatase
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

microtubule

Inferred from electronic annotation. Source: UniProtKB-KW

microtubule organizing center

Inferred from electronic annotation. Source: UniProtKB-SubCell

nucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionprotein tyrosine phosphatase activity

Inferred from electronic annotation. Source: UniProtKB-EC

Complete GO annotation...

Alternative products

This entry describes 15 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q4JDL3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q4JDL3-2)

Also known as: Variant 1;

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
Isoform 3 (identifier: Q4JDL3-3)

Also known as: Variant 10;

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSK → MGTTCLHLGTLEQSL
Isoform 4 (identifier: Q4JDL3-4)

Also known as: Variant 12;

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
Isoform 5 (identifier: Q4JDL3-5)

Also known as: Variant 13;

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     165-306: Missing.
Isoform 6 (identifier: Q4JDL3-6)

Also known as: Variant 3;

The sequence of this isoform differs from the canonical sequence as follows:
     1-192: Missing.
     193-195: LPY → MID
Isoform 7 (identifier: Q4JDL3-7)

Also known as: Variant 7;

The sequence of this isoform differs from the canonical sequence as follows:
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.
Isoform 8 (identifier: Q4JDL3-8)

Also known as: Variant 4;

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.
Isoform 9 (identifier: Q4JDL3-9)

Also known as: Variant 18;

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     165-185: ALELKNLPGEFNSGNQPSNRE → MIQHAFLLEKARTTSMLVILE
     186-420: Missing.
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 10 (identifier: Q4JDL3-10)

Also known as: Variant 8;

The sequence of this isoform differs from the canonical sequence as follows:
     165-378: Missing.
Isoform 11 (identifier: Q4JDL3-11)

Also known as: Variant 2;

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
     165-306: Missing.
Isoform 12 (identifier: Q4JDL3-12)

Also known as: Variant 11;

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSK → MGTTCLHLGTLEQSL
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.
Isoform 13 (identifier: Q4JDL3-13)

Also known as: Variant 9;

The sequence of this isoform differs from the canonical sequence as follows:
     114-145: DTRKIVSEGELDQLAQIRPLIFNFHEQTAIKD → VQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     146-420: Missing.
Isoform 14 (identifier: Q4JDL3-14)

Also known as: Variant 14;

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.
Isoform 15 (identifier: Q4JDL3-15)

Also known as: Variant 5;

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
     114-145: DTRKIVSEGELDQLAQIRPLIFNFHEQTAIKD → VQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     146-420: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 420420Tyrosine-protein phosphatase non-receptor type 20
PRO_0000295755

Regions

Domain159 – 412254Tyrosine-protein phosphatase
Region353 – 3597Substrate binding By similarity

Sites

Active site3531Phosphocysteine intermediate By similarity
Binding site3231Substrate By similarity
Binding site3971Substrate By similarity

Amino acid modifications

Modified residue1201Phosphoserine By similarity

Natural variations

Alternative sequence1 – 192192Missing in isoform 6.
VSP_027063
Alternative sequence1 – 8181Missing in isoform 4, isoform 5, isoform 9 and isoform 14.
VSP_027064
Alternative sequence1 – 4343MSSPR…TPRSK → MGTTCLHLGTLEQSL in isoform 3 and isoform 12.
VSP_027065
Alternative sequence1 – 1111MSSPRDFRAEP → MI in isoform 2, isoform 8, isoform 11 and isoform 15.
VSP_027066
Alternative sequence114 – 14532DTRKI…TAIKD → VQHHGYSGPNERTTFWHGSN EGAVSLLLRYCA in isoform 13 and isoform 15.
VSP_027067
Alternative sequence146 – 420275Missing in isoform 13 and isoform 15.
VSP_027068
Alternative sequence165 – 378214Missing in isoform 10.
VSP_027069
Alternative sequence165 – 306142Missing in isoform 5 and isoform 11.
VSP_027070
Alternative sequence165 – 18521ALELK…PSNRE → MIQHAFLLEKARTTSMLVIL E in isoform 9.
VSP_038003
Alternative sequence186 – 420235Missing in isoform 9.
VSP_038004
Alternative sequence193 – 1953LPY → MID in isoform 6.
VSP_027071
Alternative sequence195 – 22632YDSTR…EYFYI → FQHHGYSGPNERTTFWHGSN EGAVSLLLRYCA in isoform 7, isoform 8, isoform 12 and isoform 14.
VSP_027072
Alternative sequence227 – 420194Missing in isoform 7, isoform 8, isoform 12 and isoform 14.
VSP_027073

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified August 2, 2005. Version 1.
Checksum: F3A1C8041ACB710E

FASTA42048,423
        10         20         30         40         50         60 
MSSPRDFRAE PVNDYEGNDS EAEDLNFRET LPSSSQENTP RSKVFENKVN SEKVKLSLRN 

        70         80         90        100        110        120 
FPHNDYEDVF EEPSESGSDP SMWTARGPFR RDRWSSEDEE AAGPSQALSP LLSDTRKIVS 

       130        140        150        160        170        180 
EGELDQLAQI RPLIFNFHEQ TAIKDCLKIL EEKTAAYDIM QEFMALELKN LPGEFNSGNQ 

       190        200        210        220        230        240 
PSNREKNRYR DILPYDSTRV PLGKSKDYIN ASYIRIVNCG EEYFYIATQG PLLSTIDDFW 

       250        260        270        280        290        300 
QMVLENNSNV IAMITREIEG GIIKCYHYWP ISLKKPLELK HFRVFLENYQ ILQYFIIRMF 

       310        320        330        340        350        360 
QVVEKSTGTS HSVKQLQFTK WPDHGTPASA DSFIKYIRYA RKSHLTGPMV VHCSAGIGRT 

       370        380        390        400        410        420 
GVFLCVDVVF CAIVKNCSFN IMDIVAQMRE QRSGMVQTKE QYHFCYDIVL EVLRKLLTLD 

« Hide

Isoform 2 (Variant 1) [UniParc].

Checksum: 84315BC1463CF896
Show »

FASTA41147,393
Isoform 3 (Variant 10) [UniParc].

Checksum: 0117231EAC24C57B
Show »

FASTA39245,123
Isoform 4 (Variant 12) [UniParc].

Checksum: 33F1B10881A748C5
Show »

FASTA33939,184
Isoform 5 (Variant 13) [UniParc].

Checksum: 75CC97D2E52F5EE4
Show »

FASTA19722,439
Isoform 6 (Variant 3) [UniParc].

Checksum: 7A416A64EF1E9D8C
Show »

FASTA22826,374
Isoform 7 (Variant 7) [UniParc].

Checksum: 7E024F34E1952E10
Show »

FASTA22625,881
Isoform 8 (Variant 4) [UniParc].

Checksum: C4F0BC493F07E554
Show »

FASTA21724,851
Isoform 9 (Variant 18) [UniParc].

Checksum: DD927F235474DDB6
Show »

FASTA10411,999
Isoform 10 (Variant 8) [UniParc].

Checksum: 3AE7C577FAE313F6
Show »

FASTA20623,869
Isoform 11 (Variant 2) [UniParc].

Checksum: 26C149800AABD0C2
Show »

FASTA26930,648
Isoform 12 (Variant 11) [UniParc].

Checksum: 3955399CCEBDEF4E
Show »

FASTA19822,581
Isoform 13 (Variant 9) [UniParc].

Checksum: CE6E89C11FA531C9
Show »

FASTA14516,414
Isoform 14 (Variant 14) [UniParc].

Checksum: D800415BBA550F7D
Show »

FASTA14516,643
Isoform 15 (Variant 5) [UniParc].

Checksum: A29B5EC8F4DE0E89
Show »

FASTA13615,384

References

« Hide 'large scale' references
[1]"Protein tyrosine phosphatase hPTPN20a is targeted to sites of actin polymerization."
Fodero-Tavoletti M.T., Hardy M.P., Cornell B., Katsis F., Sadek C.M., Mitchell C.A., Kemp B.E., Tiganis T.
Biochem. J. 389:343-354(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14 AND 15), ENZYME ACTIVITY, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[2]"The DNA sequence and comparative analysis of human chromosome 10."
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. expand/collapse author list , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
Tissue: Heart and Lung.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY704141 mRNA. Translation: AAW28780.1.
AY704142 mRNA. Translation: AAW28781.1.
AY704143 mRNA. Translation: AAW28782.1.
AY704144 mRNA. Translation: AAW28783.1.
AY704145 mRNA. Translation: AAW28784.1.
AY704146 mRNA. Translation: AAW28785.1.
AY704147 mRNA. Translation: AAW28786.1.
AY704148 mRNA. Translation: AAW28787.1.
AY704149 mRNA. Translation: AAW28788.1.
AY704150 mRNA. Translation: AAW28789.1.
AY704151 mRNA. Translation: AAW28790.1.
AY704152 mRNA. Translation: AAW28791.1.
AY704153 mRNA. Translation: AAW28792.1.
AY704154 mRNA. Translation: AAW28793.1.
AY704158 mRNA. Translation: AAW28797.1. Sequence problems.
AY753191 mRNA. Translation: AAW88572.1.
AL450334, AL672108 Genomic DNA. Translation: CAI15685.1.
AL358791, BX005072 Genomic DNA. Translation: CAI14088.1.
AL358791, BX005072 Genomic DNA. Translation: CAI14090.1.
AL672108, AL450334 Genomic DNA. Translation: CAI12200.1.
BX005072, AL358791 Genomic DNA. Translation: CAI23640.1.
BX005072, AL358791 Genomic DNA. Translation: CAI23642.1.
BC093750 mRNA. Translation: AAH93750.1.
BC113473 mRNA. Translation: AAI13474.1.
BC143394 mRNA. Translation: AAI43395.1.
BC171725 mRNA. Translation: AAI71725.1.
RefSeqNP_001035816.1. NM_001042357.3.
NP_001035817.1. NM_001042358.3.
NP_001035818.1. NM_001042359.2.
NP_001035819.1. NM_001042360.2.
NP_001035820.1. NM_001042361.3.
NP_001035821.1. NM_001042362.2.
NP_001035822.1. NM_001042363.3.
NP_001035823.1. NM_001042364.3.
NP_001035846.1. NM_001042387.1.
NP_001035848.1. NM_001042389.1.
NP_001035849.1. NM_001042390.1.
NP_001035850.1. NM_001042391.1.
NP_001035851.1. NM_001042392.1.
NP_001035852.1. NM_001042393.1.
NP_001035853.1. NM_001042394.1.
NP_001035854.1. NM_001042395.1.
NP_001035855.1. NM_001042396.1.
NP_056420.3. NM_015605.7.
XP_005270372.1. XM_005270315.1.
XP_005277709.1. XM_005277652.1.
UniGeneHs.440733.
Hs.499552.

3D structure databases

ProteinModelPortalQ4JDL3.
SMRQ4JDL3. Positions 116-419.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid575548. 1 interaction.

PTM databases

PhosphoSiteQ4JDL3.

Polymorphism databases

DMDM121944218.

Proteomic databases

PaxDbQ4JDL3.
PRIDEQ4JDL3.

Protocols and materials databases

DNASU26095.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000331650; ENSP00000331832; ENSG00000183675. [Q4JDL3-4]
ENST00000374218; ENSP00000363335; ENSG00000204179. [Q4JDL3-4]
ENST00000374233; ENSP00000363350; ENSG00000183675. [Q4JDL3-1]
ENST00000374240; ENSP00000363357; ENSG00000183675. [Q4JDL3-7]
ENST00000374339; ENSP00000363459; ENSG00000204179. [Q4JDL3-1]
ENST00000374346; ENSP00000363466; ENSG00000204179. [Q4JDL3-7]
ENST00000395660; ENSP00000379020; ENSG00000183675. [Q4JDL3-3]
ENST00000395661; ENSP00000379021; ENSG00000183675. [Q4JDL3-10]
ENST00000395662; ENSP00000379022; ENSG00000183675. [Q4JDL3-14]
ENST00000395668; ENSP00000379027; ENSG00000183675. [Q4JDL3-4]
ENST00000395674; ENSP00000379033; ENSG00000183675. [Q4JDL3-6]
ENST00000395721; ENSP00000379071; ENSG00000204179. [Q4JDL3-4]
ENST00000395722; ENSP00000379072; ENSG00000204179. [Q4JDL3-10]
ENST00000395725; ENSP00000379075; ENSG00000204179. [Q4JDL3-14]
ENST00000395727; ENSP00000379077; ENSG00000204179. [Q4JDL3-6]
ENST00000437863; ENSP00000403444; ENSG00000204179. [Q4JDL3-3]
ENST00000502254; ENSP00000421404; ENSG00000204179. [Q4JDL3-13]
ENST00000502266; ENSP00000424728; ENSG00000183675. [Q4JDL3-14]
ENST00000502705; ENSP00000420995; ENSG00000204179. [Q4JDL3-10]
ENST00000503851; ENSP00000427676; ENSG00000204179. [Q4JDL3-15]
ENST00000505814; ENSP00000426355; ENSG00000204179. [Q4JDL3-4]
ENST00000506080; ENSP00000421921; ENSG00000204179. [Q4JDL3-3]
ENST00000507417; ENSP00000425723; ENSG00000183675. [Q4JDL3-12]
ENST00000508602; ENSP00000424491; ENSG00000204179. [Q4JDL3-12]
ENST00000509230; ENSP00000421604; ENSG00000183675. [Q4JDL3-8]
ENST00000509599; ENSP00000425012; ENSG00000204179. [Q4JDL3-7]
ENST00000509631; ENSP00000424344; ENSG00000183675. [Q4JDL3-4]
ENST00000509753; ENSP00000425285; ENSG00000183675. [Q4JDL3-3]
ENST00000509774; ENSP00000425362; ENSG00000204179. [Q4JDL3-8]
ENST00000509900; ENSP00000423819; ENSG00000204179. [Q4JDL3-14]
ENST00000510335; ENSP00000421453; ENSG00000204179. [Q4JDL3-9]
ENST00000510840; ENSP00000423545; ENSG00000183675. [Q4JDL3-10]
ENST00000511387; ENSP00000426298; ENSG00000183675. [Q4JDL3-15]
ENST00000511769; ENSP00000424283; ENSG00000204179. [Q4JDL3-2]
ENST00000512321; ENSP00000427588; ENSG00000183675. [Q4JDL3-13]
ENST00000512924; ENSP00000421999; ENSG00000183675. [Q4JDL3-5]
ENST00000513156; ENSP00000425912; ENSG00000204179. [Q4JDL3-11]
ENST00000513266; ENSP00000422839; ENSG00000204179. [Q4JDL3-5]
ENST00000513933; ENSP00000427171; ENSG00000183675. [Q4JDL3-9]
ENST00000514491; ENSP00000424942; ENSG00000183675. [Q4JDL3-2]
ENST00000514592; ENSP00000423839; ENSG00000183675. [Q4JDL3-11]
ENST00000515532; ENSP00000422953; ENSG00000183675. [Q4JDL3-7]
ENST00000577492; ENSP00000463630; ENSG00000264832. [Q4JDL3-3]
ENST00000578057; ENSP00000462327; ENSG00000264832. [Q4JDL3-8]
ENST00000578533; ENSP00000462801; ENSG00000264832. [Q4JDL3-10]
ENST00000578769; ENSP00000461946; ENSG00000264832. [Q4JDL3-11]
ENST00000579331; ENSP00000462511; ENSG00000264832. [Q4JDL3-7]
ENST00000580111; ENSP00000462277; ENSG00000264832. [Q4JDL3-12]
ENST00000580860; ENSP00000462373; ENSG00000264832. [Q4JDL3-10]
ENST00000581259; ENSP00000462053; ENSG00000264832. [Q4JDL3-13]
ENST00000581350; ENSP00000462400; ENSG00000264832. [Q4JDL3-14]
ENST00000581507; ENSP00000464379; ENSG00000264832. [Q4JDL3-14]
ENST00000582045; ENSP00000463987; ENSG00000264832. [Q4JDL3-15]
ENST00000582312; ENSP00000462983; ENSG00000264832. [Q4JDL3-2]
ENST00000582347; ENSP00000464514; ENSG00000264832. [Q4JDL3-9]
ENST00000583073; ENSP00000463133; ENSG00000264832. [Q4JDL3-7]
ENST00000583297; ENSP00000462849; ENSG00000264832. [Q4JDL3-1]
ENST00000583680; ENSP00000463932; ENSG00000264832. [Q4JDL3-5]
ENST00000583723; ENSP00000464692; ENSG00000264832. [Q4JDL3-4]
ENST00000583736; ENSP00000461975; ENSG00000264832. [Q4JDL3-3]
ENST00000584081; ENSP00000464175; ENSG00000264832. [Q4JDL3-4]
ENST00000584823; ENSP00000463290; ENSG00000264832. [Q4JDL3-6]
ENST00000584849; ENSP00000463765; ENSG00000264832. [Q4JDL3-4]
GeneID26095.
653129.
KEGGhsa:26095.
hsa:653129.
UCSCuc001jcz.1. human. [Q4JDL3-12]
uc001jdb.1. human. [Q4JDL3-13]
uc001jdc.1. human. [Q4JDL3-1]
uc001jdd.1. human. [Q4JDL3-2]
uc001jde.1. human. [Q4JDL3-6]
uc001jdf.1. human. [Q4JDL3-3]
uc001jdh.1. human. [Q4JDL3-7]
uc001jdi.1. human. [Q4JDL3-14]
uc001jdj.1. human. [Q4JDL3-5]
uc001jdm.1. human. [Q4JDL3-8]
uc001jdn.1. human. [Q4JDL3-11]
uc001jdo.1. human. [Q4JDL3-15]
uc009xmx.1. human. [Q4JDL3-10]

Organism-specific databases

CTD26095.
653129.
GeneCardsGC10M046550.
GC10M048738.
HGNCHGNC:23422. PTPN20A.
HGNC:23423. PTPN20B.
HPAHPA043337.
HPA046896.
HPA047055.
HPA048310.
MIM610630. gene.
610631. gene.
neXtProtNX_Q4JDL3.
PharmGKBPA134904835.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5599.
HOVERGENHBG095763.
InParanoidQ4JDL3.
KOK18039.
OMAFCAIVKN.
PhylomeDBQ4JDL3.
TreeFamTF315573.

Gene expression databases

BgeeQ4JDL3.
CleanExHS_PTPN20A.
GenevestigatorQ4JDL3.

Family and domain databases

InterProIPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view]
PfamPF00102. Y_phosphatase. 1 hit.
[Graphical view]
PRINTSPR00700. PRTYPHPHTASE.
SMARTSM00194. PTPc. 1 hit.
[Graphical view]
PROSITEPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50055. TYR_PHOSPHATASE_PTP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio48049.
PROQ4JDL3.
SOURCESearch...

Entry information

Entry namePTN20_HUMAN
AccessionPrimary (citable) accession number: Q4JDL3
Secondary accession number(s): A6NNH8 expand/collapse secondary AC list , B7ZKV3, Q4JDG6, Q4JDK1, Q4JDK5, Q4JDK6, Q4JDK8, Q4JDK9, Q4JDL0, Q4JDL1, Q4JDL4, Q4JDL5, Q4JDL6, Q4JDL7, Q4JDL8, Q5RJ33, Q5T1G3
Entry history
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: August 2, 2005
Last modified: April 16, 2014
This is version 75 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 10

Human chromosome 10: entries, gene names and cross-references to MIM