Q4JDL3 (PTN20_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 67.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tyrosine-protein phosphatase non-receptor type 20 Short name=hPTPN20 EC=3.1.3.48 | |||||
| Gene names |
| |||||
| Organism | Homo sapiens (Human) [Reference proteome] | |||||
| Taxonomic identifier | 9606 [NCBI] | |||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 420 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Tyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates. |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. Ref.1 |
| Subcellular location | Nucleus. Cytoplasm. Cytoplasm › cytoskeleton › centrosome. Note: Colocalizes with the microtubule-organizing center and intracellular membrane compartments. Ref.1 |
| Tissue specificity | Present in many cell lines (at protein level). Widely expressed. Ref.1 |
| Post-translational modification | Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Non-receptor class subfamily. Contains 1 tyrosine-protein phosphatase domain. |
| Sequence caution | The sequence AAW28797.1 differs from that shown. Reason: Erroneous translation. Wrong choice of frame. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton Microtubule Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase Protein phosphatase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | peptidyl-tyrosine dephosphorylation Inferred from electronic annotation. Source: GOC |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell microtubuleInferred from electronic annotation. Source: UniProtKB-KW microtubule organizing centerInferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | protein tyrosine phosphatase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 15 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q4JDL3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q4JDL3-2) Also known as: Variant 1; The sequence of this isoform differs from the canonical sequence as follows: 1-11: MSSPRDFRAEP → MI | ||||||
| Isoform 3 (identifier: Q4JDL3-3) Also known as: Variant 10; The sequence of this isoform differs from the canonical sequence as follows: 1-43: MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSK → MGTTCLHLGTLEQSL | ||||||
| Isoform 4 (identifier: Q4JDL3-4) Also known as: Variant 12; The sequence of this isoform differs from the canonical sequence as follows: 1-81: Missing. | ||||||
| Isoform 5 (identifier: Q4JDL3-5) Also known as: Variant 13; The sequence of this isoform differs from the canonical sequence as follows: 1-81: Missing. 165-306: Missing. | ||||||
| Isoform 6 (identifier: Q4JDL3-6) Also known as: Variant 3; The sequence of this isoform differs from the canonical sequence as follows: 1-192: Missing. 193-195: LPY → MID | ||||||
| Isoform 7 (identifier: Q4JDL3-7) Also known as: Variant 7; The sequence of this isoform differs from the canonical sequence as follows: 195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 227-420: Missing. | ||||||
| Isoform 8 (identifier: Q4JDL3-8) Also known as: Variant 4; The sequence of this isoform differs from the canonical sequence as follows: 1-11: MSSPRDFRAEP → MI 195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 227-420: Missing. | ||||||
| Isoform 9 (identifier: Q4JDL3-9) Also known as: Variant 18; The sequence of this isoform differs from the canonical sequence as follows: 1-81: Missing. 165-185: ALELKNLPGEFNSGNQPSNRE → MIQHAFLLEKARTTSMLVILE 186-420: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 10 (identifier: Q4JDL3-10) Also known as: Variant 8; The sequence of this isoform differs from the canonical sequence as follows: 165-378: Missing. | ||||||
| Isoform 11 (identifier: Q4JDL3-11) Also known as: Variant 2; The sequence of this isoform differs from the canonical sequence as follows: 1-11: MSSPRDFRAEP → MI 165-306: Missing. | ||||||
| Isoform 12 (identifier: Q4JDL3-12) Also known as: Variant 11; The sequence of this isoform differs from the canonical sequence as follows: 1-43: MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSK → MGTTCLHLGTLEQSL 195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 227-420: Missing. | ||||||
| Isoform 13 (identifier: Q4JDL3-13) Also known as: Variant 9; The sequence of this isoform differs from the canonical sequence as follows: 114-145: DTRKIVSEGELDQLAQIRPLIFNFHEQTAIKD → VQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 146-420: Missing. | ||||||
| Isoform 14 (identifier: Q4JDL3-14) Also known as: Variant 14; The sequence of this isoform differs from the canonical sequence as follows: 1-81: Missing. 195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 227-420: Missing. | ||||||
| Isoform 15 (identifier: Q4JDL3-15) Also known as: Variant 5; The sequence of this isoform differs from the canonical sequence as follows: 1-11: MSSPRDFRAEP → MI 114-145: DTRKIVSEGELDQLAQIRPLIFNFHEQTAIKD → VQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 146-420: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 420 | 420 | Tyrosine-protein phosphatase non-receptor type 20 | PRO_0000295755 | |||||
Regions | |||||||||
| Domain | 159 – 412 | 254 | Tyrosine-protein phosphatase | ||||||
| Region | 353 – 359 | 7 | Substrate binding By similarity | ||||||
Sites | |||||||||
| Active site | 353 | 1 | Phosphocysteine intermediate By similarity | ||||||
| Binding site | 323 | 1 | Substrate By similarity | ||||||
| Binding site | 397 | 1 | Substrate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 192 | 192 | Missing in isoform 6. | VSP_027063 | |||||
| Alternative sequence | 1 – 81 | 81 | Missing in isoform 4, isoform 5, isoform 9 and isoform 14. | VSP_027064 | |||||
| Alternative sequence | 1 – 43 | 43 | MSSPR…TPRSK → MGTTCLHLGTLEQSL in isoform 3 and isoform 12. | VSP_027065 | |||||
| Alternative sequence | 1 – 11 | 11 | MSSPRDFRAEP → MI in isoform 2, isoform 8, isoform 11 and isoform 15. | VSP_027066 | |||||
| Alternative sequence | 114 – 145 | 32 | DTRKI…TAIKD → VQHHGYSGPNERTTFWHGSN EGAVSLLLRYCA in isoform 13 and isoform 15. | VSP_027067 | |||||
| Alternative sequence | 146 – 420 | 275 | Missing in isoform 13 and isoform 15. | VSP_027068 | |||||
| Alternative sequence | 165 – 378 | 214 | Missing in isoform 10. | VSP_027069 | |||||
| Alternative sequence | 165 – 306 | 142 | Missing in isoform 5 and isoform 11. | VSP_027070 | |||||
| Alternative sequence | 165 – 185 | 21 | ALELK…PSNRE → MIQHAFLLEKARTTSMLVIL E in isoform 9. | VSP_038003 | |||||
| Alternative sequence | 186 – 420 | 235 | Missing in isoform 9. | VSP_038004 | |||||
| Alternative sequence | 193 – 195 | 3 | LPY → MID in isoform 6. | VSP_027071 | |||||
| Alternative sequence | 195 – 226 | 32 | YDSTR…EYFYI → FQHHGYSGPNERTTFWHGSN EGAVSLLLRYCA in isoform 7, isoform 8, isoform 12 and isoform 14. | VSP_027072 | |||||
| Alternative sequence | 227 – 420 | 194 | Missing in isoform 7, isoform 8, isoform 12 and isoform 14. | VSP_027073 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Protein tyrosine phosphatase hPTPN20a is targeted to sites of actin polymerization." Fodero-Tavoletti M.T., Hardy M.P., Cornell B., Katsis F., Sadek C.M., Mitchell C.A., Kemp B.E., Tiganis T. Biochem. J. 389:343-354(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10; 11; 12; 13; 14 AND 15), ENZYME ACTIVITY, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7). Tissue: Heart and Lung. |
Cross-references
Entry information
| Entry name | PTN20_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q4JDL3 Secondary accession number(s): A6NNH8 Q5T1G3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
