Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tyrosine-protein phosphatase non-receptor type 20

Gene

PTPN20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Tyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates.

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei323SubstrateBy similarity1
Active sitei353Phosphocysteine intermediatePROSITE-ProRule annotation1
Binding sitei397SubstrateBy similarity1

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Enzyme and pathway databases

BioCyciZFISH:HS05028-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Tyrosine-protein phosphatase non-receptor type 20 (EC:3.1.3.48)
Short name:
hPTPN20
Gene namesi
Name:PTPN20Imported
Synonyms:PTPN20A, PTPN20BImported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:23423. PTPN20.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000204179.
PharmGKBiPA134904835.

Polymorphism and mutation databases

BioMutaiPTPN20A.
DMDMi121944218.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002957551 – 420Tyrosine-protein phosphatase non-receptor type 20Add BLAST420

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei76PhosphoserineBy similarity1
Modified residuei120PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ4JDL3.
PRIDEiQ4JDL3.

PTM databases

DEPODiQ4JDL3.
iPTMnetiQ4JDL3.
PhosphoSitePlusiQ4JDL3.

Expressioni

Tissue specificityi

Present in many cell lines (at protein level). Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000183675.
CleanExiHS_PTPN20A.
ExpressionAtlasiQ4JDL3. baseline and differential.

Organism-specific databases

HPAiHPA043337.
HPA046896.
HPA047055.
HPA048310.

Interactioni

Protein-protein interaction databases

BioGridi117546. 1 interactor.
STRINGi9606.ENSP00000363459.

Structurei

3D structure databases

ProteinModelPortaliQ4JDL3.
SMRiQ4JDL3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini159 – 412Tyrosine-protein phosphatasePROSITE-ProRule annotationAdd BLAST254

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni353 – 359Substrate bindingBy similarity7

Sequence similaritiesi

Contains 1 tyrosine-protein phosphatase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0789. Eukaryota.
COG5599. LUCA.
GeneTreeiENSGT00830000128259.
HOVERGENiHBG095763.
InParanoidiQ4JDL3.
KOiK18039.
OMAiAMITREI.
OrthoDBiEOG091G0BZR.
PhylomeDBiQ4JDL3.
TreeFamiTF315573.

Family and domain databases

Gene3Di3.90.190.10. 1 hit.
InterProiIPR029021. Prot-tyrosine_phosphatase-like.
IPR000242. PTPase_domain.
IPR016130. Tyr_Pase_AS.
IPR003595. Tyr_Pase_cat.
IPR000387. TYR_PHOSPHATASE_dom.
[Graphical view]
PfamiPF00102. Y_phosphatase. 1 hit.
[Graphical view]
PRINTSiPR00700. PRTYPHPHTASE.
SMARTiSM00194. PTPc. 1 hit.
SM00404. PTPc_motif. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50055. TYR_PHOSPHATASE_PTP. 1 hit.
[Graphical view]

Sequences (15)i

Sequence statusi: Complete.

This entry describes 15 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q4JDL3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSPRDFRAE PVNDYEGNDS EAEDLNFRET LPSSSQENTP RSKVFENKVN
60 70 80 90 100
SEKVKLSLRN FPHNDYEDVF EEPSESGSDP SMWTARGPFR RDRWSSEDEE
110 120 130 140 150
AAGPSQALSP LLSDTRKIVS EGELDQLAQI RPLIFNFHEQ TAIKDCLKIL
160 170 180 190 200
EEKTAAYDIM QEFMALELKN LPGEFNSGNQ PSNREKNRYR DILPYDSTRV
210 220 230 240 250
PLGKSKDYIN ASYIRIVNCG EEYFYIATQG PLLSTIDDFW QMVLENNSNV
260 270 280 290 300
IAMITREIEG GIIKCYHYWP ISLKKPLELK HFRVFLENYQ ILQYFIIRMF
310 320 330 340 350
QVVEKSTGTS HSVKQLQFTK WPDHGTPASA DSFIKYIRYA RKSHLTGPMV
360 370 380 390 400
VHCSAGIGRT GVFLCVDVVF CAIVKNCSFN IMDIVAQMRE QRSGMVQTKE
410 420
QYHFCYDIVL EVLRKLLTLD
Length:420
Mass (Da):48,423
Last modified:August 2, 2005 - v1
Checksum:iF3A1C8041ACB710E
GO
Isoform 2 (identifier: Q4JDL3-2) [UniParc]FASTAAdd to basket
Also known as: Variant 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI

Show »
Length:411
Mass (Da):47,393
Checksum:i84315BC1463CF896
GO
Isoform 3 (identifier: Q4JDL3-3) [UniParc]FASTAAdd to basket
Also known as: Variant 10

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSK → MGTTCLHLGTLEQSL

Show »
Length:392
Mass (Da):45,123
Checksum:i0117231EAC24C57B
GO
Isoform 4 (identifier: Q4JDL3-4) [UniParc]FASTAAdd to basket
Also known as: Variant 12

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.

Show »
Length:339
Mass (Da):39,184
Checksum:i33F1B10881A748C5
GO
Isoform 5 (identifier: Q4JDL3-5) [UniParc]FASTAAdd to basket
Also known as: Variant 13

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     165-306: Missing.

Show »
Length:197
Mass (Da):22,439
Checksum:i75CC97D2E52F5EE4
GO
Isoform 6 (identifier: Q4JDL3-6) [UniParc]FASTAAdd to basket
Also known as: Variant 3

The sequence of this isoform differs from the canonical sequence as follows:
     1-192: Missing.
     193-195: LPY → MID

Show »
Length:228
Mass (Da):26,374
Checksum:i7A416A64EF1E9D8C
GO
Isoform 7 (identifier: Q4JDL3-7) [UniParc]FASTAAdd to basket
Also known as: Variant 7

The sequence of this isoform differs from the canonical sequence as follows:
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.

Show »
Length:226
Mass (Da):25,881
Checksum:i7E024F34E1952E10
GO
Isoform 8 (identifier: Q4JDL3-8) [UniParc]FASTAAdd to basket
Also known as: Variant 4

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.

Show »
Length:217
Mass (Da):24,851
Checksum:iC4F0BC493F07E554
GO
Isoform 9 (identifier: Q4JDL3-9) [UniParc]FASTAAdd to basket
Also known as: Variant 18

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     165-185: ALELKNLPGEFNSGNQPSNRE → MIQHAFLLEKARTTSMLVILE
     186-420: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:104
Mass (Da):11,999
Checksum:iDD927F235474DDB6
GO
Isoform 10 (identifier: Q4JDL3-10) [UniParc]FASTAAdd to basket
Also known as: Variant 8

The sequence of this isoform differs from the canonical sequence as follows:
     165-378: Missing.

Show »
Length:206
Mass (Da):23,869
Checksum:i3AE7C577FAE313F6
GO
Isoform 11 (identifier: Q4JDL3-11) [UniParc]FASTAAdd to basket
Also known as: Variant 2

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
     165-306: Missing.

Show »
Length:269
Mass (Da):30,648
Checksum:i26C149800AABD0C2
GO
Isoform 12 (identifier: Q4JDL3-12) [UniParc]FASTAAdd to basket
Also known as: Variant 11

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSK → MGTTCLHLGTLEQSL
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.

Show »
Length:198
Mass (Da):22,581
Checksum:i3955399CCEBDEF4E
GO
Isoform 13 (identifier: Q4JDL3-13) [UniParc]FASTAAdd to basket
Also known as: Variant 9

The sequence of this isoform differs from the canonical sequence as follows:
     114-145: DTRKIVSEGELDQLAQIRPLIFNFHEQTAIKD → VQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     146-420: Missing.

Show »
Length:145
Mass (Da):16,414
Checksum:iCE6E89C11FA531C9
GO
Isoform 14 (identifier: Q4JDL3-14) [UniParc]FASTAAdd to basket
Also known as: Variant 14

The sequence of this isoform differs from the canonical sequence as follows:
     1-81: Missing.
     195-226: YDSTRVPLGKSKDYINASYIRIVNCGEEYFYI → FQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     227-420: Missing.

Show »
Length:145
Mass (Da):16,643
Checksum:iD800415BBA550F7D
GO
Isoform 15 (identifier: Q4JDL3-15) [UniParc]FASTAAdd to basket
Also known as: Variant 5

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSSPRDFRAEP → MI
     114-145: DTRKIVSEGELDQLAQIRPLIFNFHEQTAIKD → VQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA
     146-420: Missing.

Show »
Length:136
Mass (Da):15,384
Checksum:iA29B5EC8F4DE0E89
GO

Sequence cautioni

The sequence AAW28797 differs from that shown. Reason: Erroneous translation. Wrong choice of frame.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0270631 – 192Missing in isoform 6. 1 PublicationAdd BLAST192
Alternative sequenceiVSP_0270641 – 81Missing in isoform 4, isoform 5, isoform 9 and isoform 14. 1 PublicationAdd BLAST81
Alternative sequenceiVSP_0270651 – 43MSSPR…TPRSK → MGTTCLHLGTLEQSL in isoform 3 and isoform 12. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_0270661 – 11MSSPRDFRAEP → MI in isoform 2, isoform 8, isoform 11 and isoform 15. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_027067114 – 145DTRKI…TAIKD → VQHHGYSGPNERTTFWHGSN EGAVSLLLRYCA in isoform 13 and isoform 15. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_027068146 – 420Missing in isoform 13 and isoform 15. 1 PublicationAdd BLAST275
Alternative sequenceiVSP_027069165 – 378Missing in isoform 10. 1 PublicationAdd BLAST214
Alternative sequenceiVSP_027070165 – 306Missing in isoform 5 and isoform 11. 1 PublicationAdd BLAST142
Alternative sequenceiVSP_038003165 – 185ALELK…PSNRE → MIQHAFLLEKARTTSMLVIL E in isoform 9. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_038004186 – 420Missing in isoform 9. 1 PublicationAdd BLAST235
Alternative sequenceiVSP_027071193 – 195LPY → MID in isoform 6. 1 Publication3
Alternative sequenceiVSP_027072195 – 226YDSTR…EYFYI → FQHHGYSGPNERTTFWHGSN EGAVSLLLRYCA in isoform 7, isoform 8, isoform 12 and isoform 14. 2 PublicationsAdd BLAST32
Alternative sequenceiVSP_027073227 – 420Missing in isoform 7, isoform 8, isoform 12 and isoform 14. 2 PublicationsAdd BLAST194

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY704141 mRNA. Translation: AAW28780.1.
AY704142 mRNA. Translation: AAW28781.1.
AY704143 mRNA. Translation: AAW28782.1.
AY704144 mRNA. Translation: AAW28783.1.
AY704145 mRNA. Translation: AAW28784.1.
AY704146 mRNA. Translation: AAW28785.1.
AY704147 mRNA. Translation: AAW28786.1.
AY704148 mRNA. Translation: AAW28787.1.
AY704149 mRNA. Translation: AAW28788.1.
AY704150 mRNA. Translation: AAW28789.1.
AY704151 mRNA. Translation: AAW28790.1.
AY704152 mRNA. Translation: AAW28791.1.
AY704153 mRNA. Translation: AAW28792.1.
AY704154 mRNA. Translation: AAW28793.1.
AY704158 mRNA. Translation: AAW28797.1. Sequence problems.
AY753191 mRNA. Translation: AAW88572.1.
AL450334, AL672108 Genomic DNA. Translation: CAI15685.1.
AL358791, BX005072 Genomic DNA. Translation: CAI14088.1.
AL358791, BX005072 Genomic DNA. Translation: CAI14090.1.
AL672108, AL450334 Genomic DNA. Translation: CAI12200.1.
BX005072, AL358791 Genomic DNA. Translation: CAI23640.1.
BX005072, AL358791 Genomic DNA. Translation: CAI23642.1.
BC093750 mRNA. Translation: AAH93750.1.
BC113473 mRNA. Translation: AAI13474.1.
BC143394 mRNA. Translation: AAI43395.1.
BC171725 mRNA. Translation: AAI71725.1.
CCDSiCCDS73105.1. [Q4JDL3-2]
CCDS73106.1. [Q4JDL3-8]
CCDS73107.1. [Q4JDL3-11]
CCDS73108.1. [Q4JDL3-15]
CCDS73109.1. [Q4JDL3-6]
CCDS73110.1. [Q4JDL3-1]
CCDS73111.1. [Q4JDL3-7]
CCDS73114.1. [Q4JDL3-4]
CCDS73115.1. [Q4JDL3-14]
CCDS81454.1. [Q4JDL3-10]
CCDS81456.1. [Q4JDL3-5]
RefSeqiNP_001035816.1. NM_001042357.4. [Q4JDL3-1]
NP_001035817.1. NM_001042358.4. [Q4JDL3-2]
NP_001035818.1. NM_001042359.3. [Q4JDL3-11]
NP_001035819.1. NM_001042360.3. [Q4JDL3-6]
NP_001035820.1. NM_001042361.4. [Q4JDL3-8]
NP_001035821.1. NM_001042362.3. [Q4JDL3-15]
NP_001035822.1. NM_001042363.4. [Q4JDL3-4]
NP_001035823.1. NM_001042364.4. [Q4JDL3-14]
NP_001307610.1. NM_001320681.1. [Q4JDL3-4]
NP_001307611.1. NM_001320682.1.
NP_001307612.1. NM_001320683.1. [Q4JDL3-7]
NP_001307613.1. NM_001320684.1. [Q4JDL3-10]
NP_001307614.1. NM_001320685.1. [Q4JDL3-3]
NP_001307615.1. NM_001320686.1. [Q4JDL3-4]
NP_001307617.1. NM_001320688.1. [Q4JDL3-5]
NP_001307618.1. NM_001320689.1.
NP_001307619.1. NM_001320690.1.
NP_001307620.1. NM_001320691.1.
NP_056420.3. NM_015605.8. [Q4JDL3-7]
XP_011537907.1. XM_011539605.2. [Q4JDL3-1]
XP_011537908.1. XM_011539606.2. [Q4JDL3-1]
XP_011537909.1. XM_011539607.2. [Q4JDL3-1]
XP_011537912.1. XM_011539610.2. [Q4JDL3-4]
XP_016871533.1. XM_017016044.1. [Q4JDL3-3]
XP_016871542.1. XM_017016053.1. [Q4JDL3-10]
XP_016871543.1. XM_017016054.1. [Q4JDL3-12]
XP_016871546.1. XM_017016057.1.
XP_016871547.1. XM_017016058.1.
XP_016871548.1. XM_017016059.1. [Q4JDL3-14]
XP_016871549.1. XM_017016060.1. [Q4JDL3-13]
UniGeneiHs.440733.
Hs.499552.
Hs.650752.

Genome annotation databases

EnsembliENST00000374218; ENSP00000363335; ENSG00000204179. [Q4JDL3-4]
ENST00000374339; ENSP00000363459; ENSG00000204179. [Q4JDL3-1]
ENST00000374346; ENSP00000363466; ENSG00000204179. [Q4JDL3-7]
ENST00000395721; ENSP00000379071; ENSG00000204179. [Q4JDL3-4]
ENST00000395725; ENSP00000379075; ENSG00000204179. [Q4JDL3-14]
ENST00000395727; ENSP00000379077; ENSG00000204179. [Q4JDL3-6]
ENST00000502254; ENSP00000421404; ENSG00000204179. [Q4JDL3-13]
ENST00000502705; ENSP00000420995; ENSG00000204179. [Q4JDL3-10]
ENST00000503851; ENSP00000427676; ENSG00000204179. [Q4JDL3-15]
ENST00000505814; ENSP00000426355; ENSG00000204179. [Q4JDL3-4]
ENST00000506080; ENSP00000421921; ENSG00000204179. [Q4JDL3-4]
ENST00000508602; ENSP00000424491; ENSG00000204179. [Q4JDL3-14]
ENST00000509599; ENSP00000425012; ENSG00000204179. [Q4JDL3-7]
ENST00000509774; ENSP00000425362; ENSG00000204179. [Q4JDL3-8]
ENST00000509900; ENSP00000423819; ENSG00000204179. [Q4JDL3-14]
ENST00000510335; ENSP00000421453; ENSG00000204179. [Q4JDL3-9]
ENST00000511769; ENSP00000424283; ENSG00000204179. [Q4JDL3-2]
ENST00000513156; ENSP00000425912; ENSG00000204179. [Q4JDL3-11]
ENST00000513266; ENSP00000422839; ENSG00000204179. [Q4JDL3-5]
GeneIDi26095.
KEGGihsa:26095.
UCSCiuc001jdb.2. human. [Q4JDL3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY704141 mRNA. Translation: AAW28780.1.
AY704142 mRNA. Translation: AAW28781.1.
AY704143 mRNA. Translation: AAW28782.1.
AY704144 mRNA. Translation: AAW28783.1.
AY704145 mRNA. Translation: AAW28784.1.
AY704146 mRNA. Translation: AAW28785.1.
AY704147 mRNA. Translation: AAW28786.1.
AY704148 mRNA. Translation: AAW28787.1.
AY704149 mRNA. Translation: AAW28788.1.
AY704150 mRNA. Translation: AAW28789.1.
AY704151 mRNA. Translation: AAW28790.1.
AY704152 mRNA. Translation: AAW28791.1.
AY704153 mRNA. Translation: AAW28792.1.
AY704154 mRNA. Translation: AAW28793.1.
AY704158 mRNA. Translation: AAW28797.1. Sequence problems.
AY753191 mRNA. Translation: AAW88572.1.
AL450334, AL672108 Genomic DNA. Translation: CAI15685.1.
AL358791, BX005072 Genomic DNA. Translation: CAI14088.1.
AL358791, BX005072 Genomic DNA. Translation: CAI14090.1.
AL672108, AL450334 Genomic DNA. Translation: CAI12200.1.
BX005072, AL358791 Genomic DNA. Translation: CAI23640.1.
BX005072, AL358791 Genomic DNA. Translation: CAI23642.1.
BC093750 mRNA. Translation: AAH93750.1.
BC113473 mRNA. Translation: AAI13474.1.
BC143394 mRNA. Translation: AAI43395.1.
BC171725 mRNA. Translation: AAI71725.1.
CCDSiCCDS73105.1. [Q4JDL3-2]
CCDS73106.1. [Q4JDL3-8]
CCDS73107.1. [Q4JDL3-11]
CCDS73108.1. [Q4JDL3-15]
CCDS73109.1. [Q4JDL3-6]
CCDS73110.1. [Q4JDL3-1]
CCDS73111.1. [Q4JDL3-7]
CCDS73114.1. [Q4JDL3-4]
CCDS73115.1. [Q4JDL3-14]
CCDS81454.1. [Q4JDL3-10]
CCDS81456.1. [Q4JDL3-5]
RefSeqiNP_001035816.1. NM_001042357.4. [Q4JDL3-1]
NP_001035817.1. NM_001042358.4. [Q4JDL3-2]
NP_001035818.1. NM_001042359.3. [Q4JDL3-11]
NP_001035819.1. NM_001042360.3. [Q4JDL3-6]
NP_001035820.1. NM_001042361.4. [Q4JDL3-8]
NP_001035821.1. NM_001042362.3. [Q4JDL3-15]
NP_001035822.1. NM_001042363.4. [Q4JDL3-4]
NP_001035823.1. NM_001042364.4. [Q4JDL3-14]
NP_001307610.1. NM_001320681.1. [Q4JDL3-4]
NP_001307611.1. NM_001320682.1.
NP_001307612.1. NM_001320683.1. [Q4JDL3-7]
NP_001307613.1. NM_001320684.1. [Q4JDL3-10]
NP_001307614.1. NM_001320685.1. [Q4JDL3-3]
NP_001307615.1. NM_001320686.1. [Q4JDL3-4]
NP_001307617.1. NM_001320688.1. [Q4JDL3-5]
NP_001307618.1. NM_001320689.1.
NP_001307619.1. NM_001320690.1.
NP_001307620.1. NM_001320691.1.
NP_056420.3. NM_015605.8. [Q4JDL3-7]
XP_011537907.1. XM_011539605.2. [Q4JDL3-1]
XP_011537908.1. XM_011539606.2. [Q4JDL3-1]
XP_011537909.1. XM_011539607.2. [Q4JDL3-1]
XP_011537912.1. XM_011539610.2. [Q4JDL3-4]
XP_016871533.1. XM_017016044.1. [Q4JDL3-3]
XP_016871542.1. XM_017016053.1. [Q4JDL3-10]
XP_016871543.1. XM_017016054.1. [Q4JDL3-12]
XP_016871546.1. XM_017016057.1.
XP_016871547.1. XM_017016058.1.
XP_016871548.1. XM_017016059.1. [Q4JDL3-14]
XP_016871549.1. XM_017016060.1. [Q4JDL3-13]
UniGeneiHs.440733.
Hs.499552.
Hs.650752.

3D structure databases

ProteinModelPortaliQ4JDL3.
SMRiQ4JDL3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117546. 1 interactor.
STRINGi9606.ENSP00000363459.

PTM databases

DEPODiQ4JDL3.
iPTMnetiQ4JDL3.
PhosphoSitePlusiQ4JDL3.

Polymorphism and mutation databases

BioMutaiPTPN20A.
DMDMi121944218.

Proteomic databases

PaxDbiQ4JDL3.
PRIDEiQ4JDL3.

Protocols and materials databases

DNASUi26095.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000374218; ENSP00000363335; ENSG00000204179. [Q4JDL3-4]
ENST00000374339; ENSP00000363459; ENSG00000204179. [Q4JDL3-1]
ENST00000374346; ENSP00000363466; ENSG00000204179. [Q4JDL3-7]
ENST00000395721; ENSP00000379071; ENSG00000204179. [Q4JDL3-4]
ENST00000395725; ENSP00000379075; ENSG00000204179. [Q4JDL3-14]
ENST00000395727; ENSP00000379077; ENSG00000204179. [Q4JDL3-6]
ENST00000502254; ENSP00000421404; ENSG00000204179. [Q4JDL3-13]
ENST00000502705; ENSP00000420995; ENSG00000204179. [Q4JDL3-10]
ENST00000503851; ENSP00000427676; ENSG00000204179. [Q4JDL3-15]
ENST00000505814; ENSP00000426355; ENSG00000204179. [Q4JDL3-4]
ENST00000506080; ENSP00000421921; ENSG00000204179. [Q4JDL3-4]
ENST00000508602; ENSP00000424491; ENSG00000204179. [Q4JDL3-14]
ENST00000509599; ENSP00000425012; ENSG00000204179. [Q4JDL3-7]
ENST00000509774; ENSP00000425362; ENSG00000204179. [Q4JDL3-8]
ENST00000509900; ENSP00000423819; ENSG00000204179. [Q4JDL3-14]
ENST00000510335; ENSP00000421453; ENSG00000204179. [Q4JDL3-9]
ENST00000511769; ENSP00000424283; ENSG00000204179. [Q4JDL3-2]
ENST00000513156; ENSP00000425912; ENSG00000204179. [Q4JDL3-11]
ENST00000513266; ENSP00000422839; ENSG00000204179. [Q4JDL3-5]
GeneIDi26095.
KEGGihsa:26095.
UCSCiuc001jdb.2. human. [Q4JDL3-1]

Organism-specific databases

CTDi26095.
GeneCardsiPTPN20.
HGNCiHGNC:23423. PTPN20.
HPAiHPA043337.
HPA046896.
HPA047055.
HPA048310.
MIMi610630. gene.
610631. gene.
neXtProtiNX_Q4JDL3.
OpenTargetsiENSG00000204179.
PharmGKBiPA134904835.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0789. Eukaryota.
COG5599. LUCA.
GeneTreeiENSGT00830000128259.
HOVERGENiHBG095763.
InParanoidiQ4JDL3.
KOiK18039.
OMAiAMITREI.
OrthoDBiEOG091G0BZR.
PhylomeDBiQ4JDL3.
TreeFamiTF315573.

Enzyme and pathway databases

BioCyciZFISH:HS05028-MONOMER.

Miscellaneous databases

PROiQ4JDL3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000183675.
CleanExiHS_PTPN20A.
ExpressionAtlasiQ4JDL3. baseline and differential.

Family and domain databases

Gene3Di3.90.190.10. 1 hit.
InterProiIPR029021. Prot-tyrosine_phosphatase-like.
IPR000242. PTPase_domain.
IPR016130. Tyr_Pase_AS.
IPR003595. Tyr_Pase_cat.
IPR000387. TYR_PHOSPHATASE_dom.
[Graphical view]
PfamiPF00102. Y_phosphatase. 1 hit.
[Graphical view]
PRINTSiPR00700. PRTYPHPHTASE.
SMARTiSM00194. PTPc. 1 hit.
SM00404. PTPc_motif. 1 hit.
[Graphical view]
SUPFAMiSSF52799. SSF52799. 1 hit.
PROSITEiPS00383. TYR_PHOSPHATASE_1. 1 hit.
PS50056. TYR_PHOSPHATASE_2. 1 hit.
PS50055. TYR_PHOSPHATASE_PTP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPTN20_HUMAN
AccessioniPrimary (citable) accession number: Q4JDL3
Secondary accession number(s): A6NNH8
, B7ZKV3, Q4JDG6, Q4JDK1, Q4JDK5, Q4JDK6, Q4JDK8, Q4JDK9, Q4JDL0, Q4JDL1, Q4JDL4, Q4JDL5, Q4JDL6, Q4JDL7, Q4JDL8, Q5RJ33, Q5T1G3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: August 2, 2005
Last modified: November 2, 2016
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.