Q4G0P3 (HYDIN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 75.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Hydrocephalus-inducing protein homolog | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 5121 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Involvement in disease | Primary ciliary dyskinesia 5 (CILD5) [MIM:608647]: An autosomal recessive form of primary dyskinesia, a disorder characterized by abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia; reduced fertility is often observed in male patients due to abnormalities of sperm tails. Half of the patients exhibit randomization of left-right body asymmetry and situs inversus, due to dysfunction of monocilia at the embryonic node. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome. CILD5 is characterized by early onset of a progressive decline in lung function due to an inability to clear mucus and particles from the airways. Affected individuals have recurrent infections of the sinuses, ears, airways, and lungs. Sperm motility is also decreased. Individuals with CILD5 do not have situs inversus. |
| Sequence caution | The sequence AAH28351.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAB15527.1 differs from that shown. Reason: Frameshift at position 4804. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Ciliopathy Primary ciliary dyskinesia |
| Domain | Coiled coil |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q4G0P3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q4G0P3-2) The sequence of this isoform differs from the canonical sequence as follows: 1-3823: Missing. 3824-3824: E → M 4887-5121: GTFSFEFQPL...WVYYLKGITL → RWGLTASSRLECSGMIIAPCSLKLLQSRPPPASAS | ||||||
| Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: Q4G0P3-5) The sequence of this isoform differs from the canonical sequence as follows: 1015-1017: IVK → VRG 1018-5121: Missing. | ||||||
| Isoform 5 (identifier: Q4G0P3-6) The sequence of this isoform differs from the canonical sequence as follows: 693-708: CVVPALHLVNTEVDFG → YCSPACSSPESPPSLQ 709-5121: Missing. | ||||||
| Isoform 6 (identifier: Q4G0P3-8) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MESAGGFKLGMEPLSGGGVCEKKKLLKM 923-923: S → R 924-5121: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 5121 | 5121 | Hydrocephalus-inducing protein homolog | PRO_0000284844 | |||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||
| Coiled coil | 1908 – 1933 | 26 | Potential | ||||||||||||||||||||||||||||||||||||||||||||
| Coiled coil | 2267 – 2365 | 99 | Potential | ||||||||||||||||||||||||||||||||||||||||||||
| Coiled coil | 2504 – 2549 | 46 | Potential | ||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 1975 – 1981 | 7 | Poly-Glu | ||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 3823 | 3823 | Missing in isoform 2. | VSP_024684 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MESAGGFKLGMEPLSGGGVC EKKKLLKM in isoform 6. | VSP_042692 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 693 – 708 | 16 | CVVPA…EVDFG → YCSPACSSPESPPSLQ in isoform 5. | VSP_024687 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 709 – 5121 | 4413 | Missing in isoform 5. | VSP_024688 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 923 | 1 | S → R in isoform 6. | VSP_042693 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 924 – 5121 | 4198 | Missing in isoform 6. | VSP_042694 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1015 – 1017 | 3 | IVK → VRG in isoform 4. | VSP_024691 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1018 – 5121 | 4104 | Missing in isoform 4. | VSP_024692 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 3824 | 1 | E → M in isoform 2. | VSP_024697 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 4887 – 5121 | 235 | GTFSF…KGITL → RWGLTASSRLECSGMIIAPC SLKLLQSRPPPASAS in isoform 2. | VSP_024698 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 451 | 1 | R → P. Corresponds to variant rs7200485 [ dbSNP | Ensembl ]. | VAR_031837 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 584 | 1 | T → N. Corresponds to variant rs7200126 [ dbSNP | Ensembl ]. | VAR_031838 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 690 | 1 | T → A. Corresponds to variant rs10744982 [ dbSNP | Ensembl ]. | VAR_031839 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 724 | 1 | N → D. Corresponds to variant rs3817211 [ dbSNP | Ensembl ]. | VAR_031840 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1077 | 1 | I → V. Corresponds to variant rs6416709 [ dbSNP | Ensembl ]. | VAR_059667 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1228 | 1 | V → L. Corresponds to variant rs1774513 [ dbSNP | Ensembl ]. | VAR_059668 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1534 | 1 | I → V. Corresponds to variant rs1774303 [ dbSNP | Ensembl ]. | VAR_059669 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1718 | 1 | V → M. Corresponds to variant rs783762 [ dbSNP | Ensembl ]. | VAR_051036 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1892 | 1 | R → H. Corresponds to variant rs783732 [ dbSNP | Ensembl ]. | VAR_051037 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 1952 | 1 | R → Q. Corresponds to variant rs17321570 [ dbSNP | Ensembl ]. | VAR_051038 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2087 | 1 | R → C. Corresponds to variant rs1774541 [ dbSNP | Ensembl ]. | VAR_059670 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2099 | 1 | V → M. Corresponds to variant rs1798337 [ dbSNP | Ensembl ]. | VAR_051039 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2242 | 1 | Q → R. Corresponds to variant rs2258307 [ dbSNP | Ensembl ]. | VAR_059671 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2276 | 1 | Q → R. Corresponds to variant rs1815707 [ dbSNP | Ensembl ]. | VAR_051040 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2298 | 1 | R → G. Corresponds to variant rs1774360 [ dbSNP | Ensembl ]. | VAR_059672 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2306 | 1 | E → G. Corresponds to variant rs2502726 [ dbSNP | Ensembl ]. | VAR_051041 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2445 | 1 | N → I. Corresponds to variant rs1798532 [ dbSNP | Ensembl ]. | VAR_051042 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2455 | 1 | P → Q. Corresponds to variant rs1798531 [ dbSNP | Ensembl ]. | VAR_061666 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2502 | 1 | L → S. Corresponds to variant rs1798529 [ dbSNP | Ensembl ]. | VAR_051043 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2530 | 1 | K → E. Corresponds to variant rs1798528 [ dbSNP | Ensembl ]. | VAR_059673 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2558 | 1 | G → E. Corresponds to variant rs8044142 [ dbSNP | Ensembl ]. | VAR_051044 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2570 | 1 | D → N. Corresponds to variant rs8044001 [ dbSNP | Ensembl ]. | VAR_059674 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2589 | 1 | K → R. Corresponds to variant rs1774395 [ dbSNP | Ensembl ]. | VAR_051045 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2694 | 1 | I → S. Corresponds to variant rs1774449 [ dbSNP | Ensembl ]. | VAR_059675 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2932 | 1 | P → L. Corresponds to variant rs11075812 [ dbSNP | Ensembl ]. | VAR_051046 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2937 | 1 | E → K. Corresponds to variant rs8047935 [ dbSNP | Ensembl ]. | VAR_051047 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2939 | 1 | R → K. Corresponds to variant rs7188837 [ dbSNP | Ensembl ]. | VAR_051048 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 2994 | 1 | E → G. Corresponds to variant rs12102425 [ dbSNP | Ensembl ]. | VAR_051049 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3116 | 1 | T → R. Corresponds to variant rs1774423 [ dbSNP | Ensembl ]. | VAR_051050 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3269 | 1 | Y → D. Corresponds to variant rs7197263 [ dbSNP | Ensembl ]. | VAR_051051 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3291 | 1 | A → P. Corresponds to variant rs1798440 [ dbSNP | Ensembl ]. | VAR_059676 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3316 | 1 | L → P. Corresponds to variant rs1774331 [ dbSNP | Ensembl ]. | VAR_059677 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3739 | 1 | A → T. Corresponds to variant rs1774504 [ dbSNP | Ensembl ]. | VAR_059678 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3742 | 1 | V → I. Corresponds to variant rs1798413 [ dbSNP | Ensembl ]. | VAR_059679 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3811 | 1 | R → H. Corresponds to variant rs13338821 [ dbSNP | Ensembl ]. | VAR_051052 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3840 | 1 | V → L. Corresponds to variant rs1798325 [ dbSNP | Ensembl ]. | VAR_059680 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3869 | 1 | M → R. Corresponds to variant rs7192347 [ dbSNP | Ensembl ]. | VAR_059681 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 3899 | 1 | V → M. Corresponds to variant rs1626593 [ dbSNP | Ensembl ]. | VAR_051053 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4005 | 1 | T → A. Corresponds to variant rs1539302 [ dbSNP | Ensembl ]. | VAR_059682 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4026 | 1 | A → T. Corresponds to variant rs11075798 [ dbSNP | Ensembl ]. | VAR_051054 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4088 | 1 | K → R. Corresponds to variant rs1774416 [ dbSNP | Ensembl ]. | VAR_051055 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4160 | 1 | E → Q. Corresponds to variant rs1798314 [ dbSNP | Ensembl ]. | VAR_059683 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4270 | 1 | H → Y. Corresponds to variant rs1891343 [ dbSNP | Ensembl ]. | VAR_051056 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4363 | 1 | S → C. Corresponds to variant rs1770434 [ dbSNP | Ensembl ]. | VAR_059684 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4412 | 1 | K → E. Corresponds to variant rs1774480 [ dbSNP | Ensembl ]. | VAR_059685 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4520 | 1 | G → S. Corresponds to variant rs2292127 [ dbSNP | Ensembl ]. | VAR_051057 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4552 | 1 | M → L. Corresponds to variant rs1770442 [ dbSNP | Ensembl ]. | VAR_059686 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4606 | 1 | N → K. Corresponds to variant rs783898 [ dbSNP | Ensembl ]. | VAR_051058 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 4869 | 1 | R → Q. Corresponds to variant rs2795652 [ dbSNP | Ensembl ]. | VAR_059687 | |||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 299 | 1 | L → P in BAB14314. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 313 | 1 | L → M in AAH28351. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 460 | 1 | K → T in BAB14314. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 532 | 1 | T → I in AAH28351. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 3945 | 1 | S → N in AAH43273. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4663 | 1 | P → T in AAH43273. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 4667 | 1 | G → V in BAB15527. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 204 – 206 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 210 – 215 | 6 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 217 – 224 | 8 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 227 – 229 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 231 – 236 | 6 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 241 – 250 | 10 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 255 – 262 | 8 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 265 – 268 | 4 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 275 – 281 | 7 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 460 – 464 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 466 – 476 | 11 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 479 – 487 | 9 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 493 – 497 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 503 – 507 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 509 – 517 | 9 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 524 – 529 | 6 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 535 – 541 | 7 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 543 – 547 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 554 – 561 | 8 | |||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 4575-5121 (ISOFORM 1). Tissue: Lung and Teratocarcinoma. |
| [2] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5). Tissue: Testis. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 715-5121 (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 4141-5121 (ISOFORM 1). Tissue: Amygdala and Testis. |
| [5] | "A 360-kb interchromosomal duplication of the human HYDIN locus." Doggett N.A., Xie G., Meincke L.J., Sutherland R.D., Mundt M.O., Berbari N.S., Davy B.E., Robinson M.L., Rudd M.K., Weber J.L., Stallings R.L., Han C. Genomics 88:762-771(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION. |
| [6] | "Recessive HYDIN mutations cause primary ciliary dyskinesia without randomization of left-right body asymmetry." Olbrich H., Schmidts M., Werner C., Onoufriadis A., Loges N.T., Raidt J., Banki N.F., Shoemark A., Burgoyne T., Al Turki S., Hurles M.E., Kohler G., Schroeder J., Nurnberg G., Nurnberg P., Chung E.M., Reinhardt R., Marthin J.K. Omran H.Am. J. Hum. Genet. 91:672-684(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN CILD5. |
| [7] | "Solution structure of the C-terminal PAPD-like domain from human HYDIN protein." RIKEN structural genomics initiative (RSGI) Submitted (JUL-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 458-563. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK022933 mRNA. Translation: BAB14314.1. AK026688 mRNA. Translation: BAB15527.1. Frameshift. AK299348 mRNA. Translation: BAG61346.1. AC027281 Genomic DNA. No translation available. AC099495 Genomic DNA. No translation available. AC138625 Genomic DNA. No translation available. BC028351 mRNA. Translation: AAH28351.2. Different initiation. BC043273 mRNA. Translation: AAH43273.1. AL122038 mRNA. Translation: CAB59178.1. AL133042 mRNA. Translation: CAB61370.1. AL137259 mRNA. Translation: CAB70660.1. | ||||||||||||||||||
| IPI | IPI00014215. IPI00296510. IPI00640533. IPI00641530. IPI00647188. IPI00843807. | ||||||||||||||||||
| PIR | T42699. T46330. | ||||||||||||||||||
| RefSeq | NP_001185471.1. NM_001198542.1. NP_001185472.1. NM_001198543.1. NP_001257903.1. NM_001270974.1. NP_060028.2. NM_017558.4. | ||||||||||||||||||
| UniGene | Hs.461229. Hs.741939. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q4G0P3. | ||||||||||||||||||
| SMR | Q4G0P3. Positions 182-296, 458-563. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q4G0P3. 1 interaction. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q4G0P3. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 145558935. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q4G0P3. | ||||||||||||||||||
| PRIDE | Q4G0P3. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000321489; ENSP00000314736; ENSG00000157423. ENST00000393567; ENSP00000377197; ENSG00000157423. ENST00000448691; ENSP00000394826; ENSG00000157423. ENST00000538248; ENSP00000444970; ENSG00000157423. | ||||||||||||||||||
| GeneID | 54768. | ||||||||||||||||||
| KEGG | hsa:54768. | ||||||||||||||||||
| UCSC | uc010cfz.2. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 54768. | ||||||||||||||||||
| GeneCards | GC16M070842. | ||||||||||||||||||
| H-InvDB | HIX0021241. HIX0161592. | ||||||||||||||||||
| HGNC | HGNC:19368. HYDIN. | ||||||||||||||||||
| HPA | HPA046282. | ||||||||||||||||||
| MIM | 608647. phenotype. 610812. gene. | ||||||||||||||||||
| neXtProt | NX_Q4G0P3. | ||||||||||||||||||
| PharmGKB | PA134866950. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG44977. | ||||||||||||||||||
| HOGENOM | HOG000171495. | ||||||||||||||||||
| HOVERGEN | HBG099337. | ||||||||||||||||||
| InParanoid | Q4G0P3. | ||||||||||||||||||
| OMA | PEYILDF. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q4G0P3. | ||||||||||||||||||
| Bgee | Q4G0P3. | ||||||||||||||||||
| CleanEx | HS_HYDIN. | ||||||||||||||||||
| Genevestigator | Q4G0P3. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 2.60.40.360. 2 hits. | ||||||||||||||||||
| InterPro | IPR008962. PapD-like. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q4G0P3. | ||||||||||||||||||
| GenomeRNAi | 54768. | ||||||||||||||||||
| NextBio | 57417. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | HYDIN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q4G0P3 Secondary accession number(s): A6NC70 Q9UBE5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |

Clusters with
