Q4AE70 (CARM1_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 65.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Histone-arginine methyltransferase CARM1 EC=2.1.1.- EC=2.1.1.125 Alternative name(s): Coactivator-associated arginine methyltransferase 1 Protein arginine N-methyltransferase 4 | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 651 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, pre-mRNA splicing, and mRNA stability. Recruited to promoters upon gene activation together with histone acetyltransferases from EP300/P300 and p160 families, methylates histone H3 at 'Arg-17' (H3R17me), forming mainly asymmetric dimethylarginine (H3R17me2a), leading to activates transcription via chromatin remodeling. During nuclear hormone receptor activation and TCF7L2/TCF4 activation, acts synergically with EP300/P300 and either one of the p160 histone acetyltransferases NCOA1/SRC1, NCOA2/GRIP1 and NCOA3/ACTR or CTNNB1/beta-catenin to activate transcription. During myogenic transcriptional activation, acts together with NCOA3/ACTR as a coactivator for MEF2C. During monocyte inflammatory stimulation, acts together with EP300/P300 as a coactivator for NF-kappa-B. Acts as coactivator for PPARG, promotes adipocyte differentiation and the accumulation of brown fat tissue. Plays a role in the regulation of pre-mRNA alternative splicing by methylation of splicing factors. Also seems to be involved in p53/TP53 transcriptional activation. Methylates EP300/P300, both at 'Arg-2142', which may loosen its interaction with NCOA2/GRIP1, and at 'Arg-580' and 'Arg-604' in the KIX domain, which impairs its interaction with CREB and inhibits CREB-dependent transcriptional activation. Also methylates arginine residues in RNA-binding proteins PABPC1, ELAVL1 and ELAV4, which may affect their mRNA-stabilizing properties and the half-life of their target mRNAs. Ref.1 Isoform 3 specifically affects pre-mRNA splicing. This activity is independent from methyltransferase activity. Ref.1 |
| Catalytic activity | S-adenosyl-L-methionine + arginine-[histone] = S-adenosyl-L-homocysteine + N(omega)-methyl-arginine-[histone]. |
| Enzyme regulation | Methylation of H3R17 (H3R17me) by CARM1 is stimulated by preacetylation of H3 'Lys-18' (H3K18ac) H3 'Lys-23' (H3K23ac) by EP300 and blocked by citrullination of H3 'Arg-17' (H3R17ci) by PADI4 By similarity. |
| Subunit structure | Homodimer Probable. Interacts with NR1H4. Interacts with the C-terminus of NCOA2/GRIP1, NCO3/ACTR and NCOA1/SRC1. Part of a complex consisting of CARM1, EP300/P300 and NCOA2/GRIP1. Interacts with FLII, TP53, myogenic factor MEF2, EP300/P300, TRIM24, CREBBP and CTNNB1. Identified in a complex containing CARM1, TRIM24 and NCOA2/GRIP1. Interacts with NCOA3/SRC3. Interacts with RELA By similarity. Interacts with SNRPC. Ref.1 Ref.3 |
| Subcellular location | Nucleus. Cytoplasm. Note: Mainly nuclear during the G1, S and G2 phases of the cell cycle. Cytoplasmic during mitosis, after breakup of the nuclear membrane By similarity. Ref.2 |
| Tissue specificity | Isoform 1 is expressed at low levels in brain, liver and testis. Isoform 2 is highly expressed in brain, liver, skeletal muscle and testis. Isoform 3 is highly expressed in spleen, liver and kidney. Isoform 4 is expressed in spleen, liver and kidney. Ref.1 |
| Developmental stage | Isoforms 2 and 3 are expressed in fetal brain. Ref.1 |
| Post-translational modification | Auto-methylated on Arg-551. Methylation enhances transcription coactivator activity. Methylation is required for its role in the regulation of pre-mRNA alternative splicing By similarity. Ref.2 Phosphorylation at Ser-217 interferes with S-adenosyl-L-methionine binding and strongly reduces methyltransferase activity. Phosphorylation at Ser-217 is strongly increased during mitosis, and decreases rapidly to a very low, basal level after entry into the G1 phase of the cell cycle. Phosphorylation at Ser-217 may promote location in the cytosol By similarity. |
| Sequence similarities | Belongs to the protein arginine N-methyltransferase family. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Named isoforms=2. | ||||||
| Isoform 1 (identifier: Q4AE70-1) Also known as: CARM1-v2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q4AE70-2) Also known as: CARM1-v1; The sequence of this isoform differs from the canonical sequence as follows: 564-606: Missing. | ||||||
| Isoform 3 (identifier: Q4AE70-3) Also known as: CARM1-v3; The sequence of this isoform differs from the canonical sequence as follows: 540-643: ANTGIVNHTH...ISMASPMSIP → GECPLGSMACQGRTGICQWPAKPVLGSLPPLSLS 644-651: Missing. | ||||||
| Isoform 4 (identifier: Q4AE70-4) Also known as: CARM1-v4; The sequence of this isoform differs from the canonical sequence as follows: 540-605: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||||||||||||||||||||||
| Chain | 2 – 651 | 650 | Histone-arginine methyltransferase CARM1 | PRO_0000249250 | |||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||
| Region | 500 – 651 | 152 | Transactivation domain By similarity | ||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||
| Binding site | 160 | 1 | S-adenosyl-L-methionine | ||||||||||||||||||||||||||
| Binding site | 169 | 1 | S-adenosyl-L-methionine | ||||||||||||||||||||||||||
| Binding site | 193 | 1 | S-adenosyl-L-methionine; via carbonyl oxygen | ||||||||||||||||||||||||||
| Binding site | 215 | 1 | S-adenosyl-L-methionine | ||||||||||||||||||||||||||
| Binding site | 244 | 1 | S-adenosyl-L-methionine | ||||||||||||||||||||||||||
| Binding site | 272 | 1 | S-adenosyl-L-methionine | ||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine By similarity | ||||||||||||||||||||||||||
| Modified residue | 217 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||
| Modified residue | 551 | 1 | Dimethylated arginine By similarity | ||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||
| Alternative sequence | 540 – 643 | 104 | ANTGI…PMSIP → GECPLGSMACQGRTGICQWP AKPVLGSLPPLSLS in isoform 3. | VSP_020382 | |||||||||||||||||||||||||
| Alternative sequence | 540 – 605 | 66 | Missing in isoform 4. | VSP_020383 | |||||||||||||||||||||||||
| Alternative sequence | 564 – 606 | 43 | Missing in isoform 2. | VSP_020384 | |||||||||||||||||||||||||
| Alternative sequence | 644 – 651 | 8 | Missing in isoform 3. | VSP_020385 | |||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||
| Beta strand | 31 – 33 | 3 | |||||||||||||||||||||||||||
| Beta strand | 37 – 41 | 5 | |||||||||||||||||||||||||||
| Beta strand | 52 – 54 | 3 | |||||||||||||||||||||||||||
| Beta strand | 58 – 61 | 4 | |||||||||||||||||||||||||||
| Beta strand | 70 – 73 | 4 | |||||||||||||||||||||||||||
| Beta strand | 79 – 86 | 8 | |||||||||||||||||||||||||||
| Beta strand | 89 – 94 | 6 | |||||||||||||||||||||||||||
| Beta strand | 98 – 102 | 5 | |||||||||||||||||||||||||||
| Beta strand | 107 – 111 | 5 | |||||||||||||||||||||||||||
| Helix | 115 – 128 | 14 | |||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Coactivator-associated arginine methyltransferase 1, CARM1, affects pre-mRNA splicing in an isoform-specific manner." Ohkura N., Takahashi M., Yaguchi H., Nagamura Y., Tsukada T. J. Biol. Chem. 280:28927-28935(2005) [PubMed: 15944154] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), FUNCTION OF ISOFORM 3, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, INTERACTION WITH SNRPC. Tissue: Fetal brain. |
| [2] | "CARM1 regulates proliferation of PC12 cells by methylating HuD." Fujiwara T., Mori Y., Chu D.L., Koyama Y., Miyata S., Tanaka H., Yachi K., Kubo T., Yoshikawa H., Tohyama M. Mol. Cell. Biol. 26:2273-2285(2006) [PubMed: 16508003] [Abstract] Cited for: METHYLATION OF ELAV4, SUBCELLULAR LOCATION. |
| [3] | "Functional insights from structures of coactivator-associated arginine methyltransferase 1 domains." Troffer-Charlier N., Cura V., Hassenboehler P., Moras D., Cavarelli J. EMBO J. 26:4391-4401(2007) [PubMed: 17882262] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.55 ANGSTROMS) OF 28-507 IN COMPLEX WITH S-ADENOSYL-L-HOMOCYSTEINE, SUBUNIT, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB201114 mRNA. Translation: BAE16333.1. AB201115 mRNA. Translation: BAE16334.1. AB201116 mRNA. Translation: BAE16335.1. AB201117 mRNA. Translation: BAE16336.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00366497. IPI00568674. IPI00650083. IPI00655258. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001025212.1. NM_001030041.3. NP_001029260.1. NM_001034088.2. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q4AE70. | ||||||||||||||||||||||||||||||
| SMR | Q4AE70. Positions 28-131, 142-478. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| IntAct | Q4AE70. 1 interaction. | ||||||||||||||||||||||||||||||
| STRING | Q4AE70. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PRIDE | Q4AE70. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENSRNOT00000041577; ENSRNOP00000049428; ENSRNOG00000031129. ENSRNOT00000048245; ENSRNOP00000042739; ENSRNOG00000031129. | ||||||||||||||||||||||||||||||
| GeneID | 363026. | ||||||||||||||||||||||||||||||
| KEGG | rno:363026. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 10498. | ||||||||||||||||||||||||||||||
| RGD | 1305879. Carm1. | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | roNOG12713. | ||||||||||||||||||||||||||||||
| GeneTree | ENSGT00550000074406. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG050797. | ||||||||||||||||||||||||||||||
| InParanoid | Q4AE70. | ||||||||||||||||||||||||||||||
| OMA | LTIGDAN. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4XKV6M. | ||||||||||||||||||||||||||||||
| PhylomeDB | Q4AE70. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | Q4AE70. | ||||||||||||||||||||||||||||||
| Genevestigator | Q4AE70. | ||||||||||||||||||||||||||||||
| GermOnline | ENSRNOG00000031129. Rattus norvegicus. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR020989. Histone-Arg_MeTrfase_N. IPR007857. Skb1_MeTrfase. [Graphical view] | ||||||||||||||||||||||||||||||
| KO | K05931. | ||||||||||||||||||||||||||||||
| Pfam | PF11531. CARM1. 1 hit. PF05185. PRMT5. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| NextBio | 682177. | ||||||||||||||||||||||||||||||
Entry information
| Entry name | CARM1_RAT | ||||||||
| Accession | Primary (citable) accession number: Q4AE70 Secondary accession number(s): Q4AE68, Q4AE69, Q4AE71 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with