Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sodium-coupled monocarboxylate transporter 2

Gene

Slc5a12

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as an electroneutral and low-affinity sodium (Na+)-dependent sodium-coupled solute transporter. Catalyzes the transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, nicotinate, propionate, butyrate and beta-D-hydroxybutyrate. May be responsible for the first step of reabsorption of monocarboxylates from the lumen of the proximal tubule of the kidney and the small intestine. May play also a role in monocarboxylates transport in the retina. Mediates electroneutral uptake of lactate, with a stoichiometry of 2 Na+ for each lactate.2 Publications

GO - Molecular functioni

  • lactate transmembrane transporter activity Source: CACAO
  • symporter activity Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Biological processIon transport, Sodium transport, Symport, Transport
LigandSodium

Enzyme and pathway databases

ReactomeiR-MMU-427601 Multifunctional anion exchangers

Names & Taxonomyi

Protein namesi
Recommended name:
Sodium-coupled monocarboxylate transporter 2
Alternative name(s):
Electroneutral sodium monocarboxylate cotransporter
Low-affinity sodium-lactate cotransporter
Solute carrier family 5 member 12
Gene namesi
Name:Slc5a12
Synonyms:Smct2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:2138890 Slc5a12

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 9ExtracellularSequence analysis9
Transmembranei10 – 30HelicalSequence analysisAdd BLAST21
Topological domaini31 – 47CytoplasmicSequence analysisAdd BLAST17
Transmembranei48 – 68HelicalSequence analysisAdd BLAST21
Topological domaini69 – 80ExtracellularSequence analysisAdd BLAST12
Transmembranei81 – 101HelicalSequence analysisAdd BLAST21
Topological domaini102 – 128CytoplasmicSequence analysisAdd BLAST27
Transmembranei129 – 149HelicalSequence analysisAdd BLAST21
Topological domaini150 – 157ExtracellularSequence analysis8
Transmembranei158 – 178HelicalSequence analysisAdd BLAST21
Topological domaini179 – 180CytoplasmicSequence analysis2
Transmembranei181 – 201HelicalSequence analysisAdd BLAST21
Topological domaini202 – 235ExtracellularSequence analysisAdd BLAST34
Transmembranei236 – 256HelicalSequence analysisAdd BLAST21
Topological domaini257 – 275CytoplasmicSequence analysisAdd BLAST19
Transmembranei276 – 296HelicalSequence analysisAdd BLAST21
Topological domaini297 – 321ExtracellularSequence analysisAdd BLAST25
Transmembranei322 – 342HelicalSequence analysisAdd BLAST21
Topological domaini343 – 385CytoplasmicSequence analysisAdd BLAST43
Transmembranei386 – 406HelicalSequence analysisAdd BLAST21
Topological domaini407 – 411ExtracellularSequence analysis5
Transmembranei412 – 432HelicalSequence analysisAdd BLAST21
Topological domaini433 – 437CytoplasmicSequence analysis5
Transmembranei438 – 458HelicalSequence analysisAdd BLAST21
Topological domaini459 – 504ExtracellularSequence analysisAdd BLAST46
Transmembranei505 – 525HelicalSequence analysisAdd BLAST21
Topological domaini526 – 619CytoplasmicSequence analysisAdd BLAST94

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003376811 – 619Sodium-coupled monocarboxylate transporter 2Add BLAST619

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi219N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi480N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ49B93
PRIDEiQ49B93

PTM databases

iPTMnetiQ49B93
PhosphoSitePlusiQ49B93

Expressioni

Tissue specificityi

Expressed in the cortical region of the kidney corresponding to the proximal tubule. Expressed in Mueller cells of the inner retina (at protein level). Isoform 1 is expressed in the retina, kidney, small intestine and skeletal muscle. Isoform 2 is not detected in the kidney, small intestine and skeletal muscle. In the kidney, expressed predominantly in tubular epithelial cells of the cortical region and in the convoluted portions of the proximal tubule (pars convoluta). In the small intestine, its expression is highest in the proximal part and gradually decreased towards the distal end. Expressed in the neural retina. Not detected in the caecum and colon.4 Publications

Inductioni

Up-regulated by CEBPD.1 Publication

Gene expression databases

BgeeiENSMUSG00000041644
ExpressionAtlasiQ49B93 baseline and differential
GenevisibleiQ49B93 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000047340

Structurei

3D structure databases

ProteinModelPortaliQ49B93
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2349 Eukaryota
COG0591 LUCA
GeneTreeiENSGT00760000118955
HOGENOMiHOG000261662
HOVERGENiHBG057280
InParanoidiQ49B93
KOiK14388
OMAiFCFWSKK
OrthoDBiEOG091G07OC
PhylomeDBiQ49B93
TreeFamiTF316728

Family and domain databases

Gene3Di1.20.1730.10, 1 hit
InterProiView protein in InterPro
IPR038377 Na/Glc_symporter_sf
IPR001734 Na/solute_symporter
PfamiView protein in Pfam
PF00474 SSF, 1 hit
TIGRFAMsiTIGR00813 sss, 1 hit
PROSITEiView protein in PROSITE
PS50283 NA_SOLUT_SYMP_3, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q49B93-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRVKNFEAWD YVVFAGLFVI SSGIGVFFAI KERKKTTSRE FLVGGRQMSF
60 70 80 90 100
GPVALSLTAS FMSAVTVLGT PAEVYRFGAS FFLFLISYVF VVFFTSELFL
110 120 130 140 150
PVFYRSGITS TYEYLQLRFN KPVRYAATII YIVQTILYTG VVVYAPALAL
160 170 180 190 200
NQVTGFNLWA SVFATGIVCT FYCSLGGLKA VVWTDAFQMV VMIVGFLTVL
210 220 230 240 250
IQGSNHVGGF NNVLEKAGNG SRLHIVDFDV DPLRRHTFWT ITIGGTFTWL
260 270 280 290 300
GVYGVNQSTI QRCISCKTEK HAKLALYFNL LGLWIIVACA VFSGLIMYSH
310 320 330 340 350
FKDCDPWTSG VISAPDQLMP YFVMEIFATM PGLPGLFVAC AFSGTLSTVA
360 370 380 390 400
ASINALATVT FEDFVKSCFP HLSDKLSTWI SKGLCILFGI MCTSMAVVAS
410 420 430 440 450
LMGSVVQAAL SIHGMCGGPM LGLFTLGLVF PFVNWKGALG GLLTGITLSF
460 470 480 490 500
WVAIGSFIYP APESKTLPLP LSTEHCVELN ITTTVAPQIS SRPVLADTWY
510 520 530 540 550
SLSYLYFSAV GCLGCIAAGI IISFLTGKQR GKDIDPLLIR PVCNLFCFWS
560 570 580 590 600
KKYKTLCWCG VQHDRETEQD YLDSGSAWKQ GVESGLQNGL KQDTLAQIPG
610
YNPKEKSYSN SVPEKTTYF
Length:619
Mass (Da):67,951
Last modified:September 13, 2005 - v1
Checksum:iB1C36211590A511A
GO
Isoform 2 (identifier: Q49B93-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     409-436: ALSIHGMCGGPMLGLFTLGLVFPFVNWK → PGIVSQERAITGSFQRNLASVCYGVSIWKLIM

Note: No experimental confirmation available.
Show »
Length:623
Mass (Da):68,470
Checksum:iD4103BC260819E86
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_033996409 – 436ALSIH…FVNWK → PGIVSQERAITGSFQRNLAS VCYGVSIWKLIM in isoform 2. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY964639 mRNA Translation: AAY32930.1
AF529222 mRNA Translation: AAQ09530.1
AK144004 mRNA Translation: BAE25658.1
AK165419 mRNA Translation: BAE38174.1
AL732495, BX005257 Genomic DNA Translation: CAM26858.1
AL732495, BX005257 Genomic DNA Translation: CAM26859.1
BX005257, AL732495 Genomic DNA Translation: CAM27818.1
BX005257, AL732495 Genomic DNA Translation: CAM27819.1
BC121791 mRNA Translation: AAI21792.1
CCDSiCCDS16512.1 [Q49B93-2]
CCDS50656.1 [Q49B93-1]
RefSeqiNP_001003915.1, NM_001003915.2 [Q49B93-2]
NP_001171095.1, NM_001177624.1 [Q49B93-1]
UniGeneiMm.277148

Genome annotation databases

EnsembliENSMUST00000045972; ENSMUSP00000047340; ENSMUSG00000041644 [Q49B93-2]
ENSMUST00000111026; ENSMUSP00000106655; ENSMUSG00000041644 [Q49B93-1]
GeneIDi241612
KEGGimmu:241612
UCSCiuc008lmw.2 mouse [Q49B93-2]
uc008lmx.2 mouse [Q49B93-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSC5AC_MOUSE
AccessioniPrimary (citable) accession number: Q49B93
Secondary accession number(s): Q0D2G1, Q6A4K8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: September 13, 2005
Last modified: March 28, 2018
This is version 111 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health