Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 14

Gene

CCDC14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Negatively regulates centriole duplication. Negatively regulates CEP63 and CDK2 centrosomal localization.2 Publications

GO - Biological processi

  • protein localization to centrosome Source: UniProtKB
  • substantia nigra development Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 14
Gene namesi
Name:CCDC14
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:25766. CCDC14.

Subcellular locationi

GO - Cellular componenti

  • centriolar satellite Source: UniProtKB
  • centrosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000175455.
PharmGKBiPA134990564.

Polymorphism and mutation databases

BioMutaiCCDC14.
DMDMi296439419.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003330431 – 953Coiled-coil domain-containing protein 14Add BLAST953

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei124PhosphoserineCombined sources1
Modified residuei670PhosphoserineCombined sources1
Modified residuei754PhosphoserineCombined sources1
Modified residuei798PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ49A88.
MaxQBiQ49A88.
PaxDbiQ49A88.
PeptideAtlasiQ49A88.
PRIDEiQ49A88.

PTM databases

iPTMnetiQ49A88.
PhosphoSitePlusiQ49A88.

Expressioni

Gene expression databases

BgeeiENSG00000175455.
CleanExiHS_CCDC14.
ExpressionAtlasiQ49A88. baseline and differential.
GenevisibleiQ49A88. HS.

Organism-specific databases

HPAiHPA035278.
HPA035279.

Interactioni

Subunit structurei

Interacts with CEP63.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
MAGEA11P43364-23EBI-751035,EBI-10178634
PEX5P505423EBI-751035,EBI-597835

Protein-protein interaction databases

BioGridi122281. 76 interactors.
DIPiDIP-47727N.
IntActiQ49A88. 54 interactors.
MINTiMINT-1475574.
STRINGi9606.ENSP00000395706.

Structurei

3D structure databases

ProteinModelPortaliQ49A88.
SMRiQ49A88.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili383 – 413Sequence analysisAdd BLAST31
Coiled coili483 – 618Sequence analysisAdd BLAST136

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IEYX. Eukaryota.
ENOG4111JMN. LUCA.
GeneTreeiENSGT00390000017916.
HOVERGENiHBG107612.
InParanoidiQ49A88.
KOiK16541.
OMAiQFKLEAA.
OrthoDBiEOG091G01CI.
PhylomeDBiQ49A88.
TreeFamiTF332390.

Family and domain databases

InterProiIPR029343. CCDC14.
[Graphical view]
PANTHERiPTHR22367. PTHR22367. 1 hit.
PfamiPF15254. CCDC14. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q49A88-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKRGIRRDPF RKRKLGGRAK KVREPTAVNS FYREASLPSV WASLRRREMV
60 70 80 90 100
RSGARPGQVL SSGRHTGPAK LTNGKKATYL RKIPRFNADS GYSIHSDSES
110 120 130 140 150
QAETVHGLDG CASLLRDILR NEDSGSETAY LENRSNSRPL ESKRYGSKKK
160 170 180 190 200
RHEKHTIPLV VQKETSSSDN KKQIPNEASA RSERDTSDLE QNWSLQDHYR
210 220 230 240 250
MYSPIIYQAL CEHVQTQMSL MNDLTSKNIP NGIPAVPCHA PSHSESQATP
260 270 280 290 300
HSSYGLCTST PVWSLQRPPC PPKVHSEVQT DGNSQFASQG KTVSATCTDV
310 320 330 340 350
LRNSFNTSPG VPCSLPKTDI SAIPTLQQLG LVNGILPQQG IHKETDLLKC
360 370 380 390 400
IQTYLSLFRS HGKETHLDSQ THRSPTQSQP AFLATNEEKC AREQIREATS
410 420 430 440 450
ERKDLNIHVR DTKTVKDVQK AKNVNKTAEK VRIIKYLLGE LKALVAEQED
460 470 480 490 500
SEIQRLITEM EACISVLPTV SGNTDIQVEI ALAMQPLRSE NAQLRRQLRI
510 520 530 540 550
LNQQLREQQK TQKPSGAVDC NLELFSLQSL NMSLQNQLEE SLKSQELLQS
560 570 580 590 600
KNEELLKVIE NQKDENKKFS SIFKDKDQTI LENKQQYDIE ITRIKIELEE
610 620 630 640 650
ALVNVKSSQF KLETAEKENQ ILGITLRQRD AEVTRLRELT RTLQTSMAKL
660 670 680 690 700
LSDLSVDSAR CKPGNNLTKS LLNIHDKQLQ HDPAPAHTSI MSYLNKLETN
710 720 730 740 750
YSFTHSEPLS TIKNEETIEP DKTYENVLSS RGPQNSNTRG MEEASAPGII
760 770 780 790 800
SALSKQDSDE GSETMALIED EHNLDNTIYI PFARSTPEKK SPLSKRLSPQ
810 820 830 840 850
PQIRAATTQL VSNSGLAVSG KENKLCTPVI CSSSTKEAED APEKLSRASD
860 870 880 890 900
MKDTQLLKKI KEAIGKIPAA TKEPEEQTAC HGPSGCLSNS LQVKGNTVCD
910 920 930 940 950
GSVFTSDLMS DWSISSFSTF TSRDEQDFRN GLAALDANIA RLQKSLRTGL

LEK
Length:953
Mass (Da):106,302
Last modified:May 18, 2010 - v3
Checksum:i3B4335D2641E476A
GO
Isoform 2 (identifier: Q49A88-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-200: Missing.

Show »
Length:753
Mass (Da):83,599
Checksum:i8F64730141A16627
GO
Isoform 3 (identifier: Q49A88-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-160: Missing.
     161-166: VQKETS → MPMESA

Note: No experimental confirmation available.
Show »
Length:793
Mass (Da):88,234
Checksum:iFB67E9C79E3A72A1
GO
Isoform 4 (identifier: Q49A88-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-200: Missing.
     642-655: TLQTSMAKLLSDLS → KQKMHLKNFPEHLI
     656-953: Missing.

Note: No experimental confirmation available.
Show »
Length:455
Mass (Da):51,459
Checksum:iDA30C10CCA089186
GO
Isoform 5 (identifier: Q49A88-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     290-448: Missing.

Show »
Length:794
Mass (Da):88,660
Checksum:iD91FEFED17625785
GO
Isoform 6 (identifier: Q49A88-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-166: GSETAYLENRSNSRPLESKRYGSKKKRHEKHTIPLVVQKETS → A

Show »
Length:912
Mass (Da):101,520
Checksum:i0CB80C2F67416034
GO

Sequence cautioni

The sequence BAB14329 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB55229 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti403K → R in CAD97804 (PubMed:17974005).Curated1
Sequence conflicti580I → T in AAH42613 (PubMed:15489334).Curated1
Sequence conflicti585Q → H in BAH11968 (PubMed:14702039).Curated1
Sequence conflicti689S → P in BAH11968 (PubMed:14702039).Curated1
Sequence conflicti790K → E in AAH42613 (PubMed:15489334).Curated1
Sequence conflicti821K → E in BAB14329 (PubMed:14702039).Curated1
Sequence conflicti886C → G in AAH42613 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043116365T → P.3 PublicationsCorresponds to variant rs17310144dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0334551 – 200Missing in isoform 2 and isoform 4. 2 PublicationsAdd BLAST200
Alternative sequenceiVSP_0334561 – 160Missing in isoform 3. 1 PublicationAdd BLAST160
Alternative sequenceiVSP_039080125 – 166GSETA…QKETS → A in isoform 6. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_033457161 – 166VQKETS → MPMESA in isoform 3. 1 Publication6
Alternative sequenceiVSP_033458290 – 448Missing in isoform 5. 1 PublicationAdd BLAST159
Alternative sequenceiVSP_033459642 – 655TLQTS…LSDLS → KQKMHLKNFPEHLI in isoform 4. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_033460656 – 953Missing in isoform 4. 1 PublicationAdd BLAST298

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX537652 mRNA. Translation: CAD97804.1.
AL122079 mRNA. Translation: CAB59254.1.
AL833312 mRNA. Translation: CAD91162.1.
AK022954 mRNA. Translation: BAB14329.1. Different initiation.
AK027607 mRNA. Translation: BAB55229.1. Different initiation.
AK295091 mRNA. Translation: BAH11968.1.
AC117381 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW79430.1.
CH471052 Genomic DNA. Translation: EAW79434.1.
BC020246 mRNA. Translation: AAH20246.1.
BC040285 mRNA. Translation: AAH40285.1.
BC042613 mRNA. Translation: AAH42613.1.
CCDSiCCDS3025.2. [Q49A88-6]
CCDS77806.1. [Q49A88-2]
RefSeqiNP_001295246.1. NM_001308317.1. [Q49A88-2]
NP_073594.4. NM_022757.4. [Q49A88-6]
XP_005247767.1. XM_005247710.4. [Q49A88-1]
XP_005247768.1. XM_005247711.4. [Q49A88-5]
XP_005247770.1. XM_005247713.2. [Q49A88-2]
XP_005247771.1. XM_005247714.2. [Q49A88-2]
XP_016862545.1. XM_017007056.1. [Q49A88-3]
XP_016862547.1. XM_017007058.1. [Q49A88-2]
XP_016862548.1. XM_017007059.1.
UniGeneiHs.645028.

Genome annotation databases

EnsembliENST00000433542; ENSP00000395706; ENSG00000175455. [Q49A88-6]
ENST00000485727; ENSP00000418002; ENSG00000175455. [Q49A88-2]
ENST00000488653; ENSP00000420180; ENSG00000175455. [Q49A88-6]
ENST00000489746; ENSP00000418403; ENSG00000175455. [Q49A88-2]
GeneIDi64770.
KEGGihsa:64770.
UCSCiuc003egx.5. human. [Q49A88-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX537652 mRNA. Translation: CAD97804.1.
AL122079 mRNA. Translation: CAB59254.1.
AL833312 mRNA. Translation: CAD91162.1.
AK022954 mRNA. Translation: BAB14329.1. Different initiation.
AK027607 mRNA. Translation: BAB55229.1. Different initiation.
AK295091 mRNA. Translation: BAH11968.1.
AC117381 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW79430.1.
CH471052 Genomic DNA. Translation: EAW79434.1.
BC020246 mRNA. Translation: AAH20246.1.
BC040285 mRNA. Translation: AAH40285.1.
BC042613 mRNA. Translation: AAH42613.1.
CCDSiCCDS3025.2. [Q49A88-6]
CCDS77806.1. [Q49A88-2]
RefSeqiNP_001295246.1. NM_001308317.1. [Q49A88-2]
NP_073594.4. NM_022757.4. [Q49A88-6]
XP_005247767.1. XM_005247710.4. [Q49A88-1]
XP_005247768.1. XM_005247711.4. [Q49A88-5]
XP_005247770.1. XM_005247713.2. [Q49A88-2]
XP_005247771.1. XM_005247714.2. [Q49A88-2]
XP_016862545.1. XM_017007056.1. [Q49A88-3]
XP_016862547.1. XM_017007058.1. [Q49A88-2]
XP_016862548.1. XM_017007059.1.
UniGeneiHs.645028.

3D structure databases

ProteinModelPortaliQ49A88.
SMRiQ49A88.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122281. 76 interactors.
DIPiDIP-47727N.
IntActiQ49A88. 54 interactors.
MINTiMINT-1475574.
STRINGi9606.ENSP00000395706.

PTM databases

iPTMnetiQ49A88.
PhosphoSitePlusiQ49A88.

Polymorphism and mutation databases

BioMutaiCCDC14.
DMDMi296439419.

Proteomic databases

EPDiQ49A88.
MaxQBiQ49A88.
PaxDbiQ49A88.
PeptideAtlasiQ49A88.
PRIDEiQ49A88.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000433542; ENSP00000395706; ENSG00000175455. [Q49A88-6]
ENST00000485727; ENSP00000418002; ENSG00000175455. [Q49A88-2]
ENST00000488653; ENSP00000420180; ENSG00000175455. [Q49A88-6]
ENST00000489746; ENSP00000418403; ENSG00000175455. [Q49A88-2]
GeneIDi64770.
KEGGihsa:64770.
UCSCiuc003egx.5. human. [Q49A88-1]

Organism-specific databases

CTDi64770.
GeneCardsiCCDC14.
H-InvDBHIX0003617.
HGNCiHGNC:25766. CCDC14.
HPAiHPA035278.
HPA035279.
neXtProtiNX_Q49A88.
OpenTargetsiENSG00000175455.
PharmGKBiPA134990564.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEYX. Eukaryota.
ENOG4111JMN. LUCA.
GeneTreeiENSGT00390000017916.
HOVERGENiHBG107612.
InParanoidiQ49A88.
KOiK16541.
OMAiQFKLEAA.
OrthoDBiEOG091G01CI.
PhylomeDBiQ49A88.
TreeFamiTF332390.

Miscellaneous databases

ChiTaRSiCCDC14. human.
GenomeRNAii64770.
PROiQ49A88.

Gene expression databases

BgeeiENSG00000175455.
CleanExiHS_CCDC14.
ExpressionAtlasiQ49A88. baseline and differential.
GenevisibleiQ49A88. HS.

Family and domain databases

InterProiIPR029343. CCDC14.
[Graphical view]
PANTHERiPTHR22367. PTHR22367. 1 hit.
PfamiPF15254. CCDC14. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCCD14_HUMAN
AccessioniPrimary (citable) accession number: Q49A88
Secondary accession number(s): B7Z2T2
, B8ZZ41, B8ZZ58, D3DN98, Q7Z3N3, Q86T30, Q8IWF8, Q8WUJ8, Q96K47, Q9H9A3, Q9UFH0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 18, 2010
Last modified: November 30, 2016
This is version 95 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.