Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q49A17

- GLTL6_HUMAN

UniProt

Q49A17 - GLTL6_HUMAN

Protein

Polypeptide N-acetylgalactosaminyltransferase-like 6

Gene

GALNTL6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 80 (01 Oct 2014)
      Sequence version 2 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.By similarity

    Catalytic activityi

    UDP-N-acetyl-alpha-D-galactosamine + polypeptide = UDP + N-acetyl-alpha-D-galactosaminyl-polypeptide.

    Cofactori

    Manganese.By similarity

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei180 – 1801SubstrateBy similarity
    Binding sitei209 – 2091SubstrateBy similarity
    Metal bindingi232 – 2321ManganeseBy similarity
    Binding sitei233 – 2331SubstrateBy similarity
    Metal bindingi234 – 2341ManganeseBy similarity
    Binding sitei337 – 3371SubstrateBy similarity
    Metal bindingi365 – 3651ManganeseBy similarity
    Binding sitei368 – 3681SubstrateBy similarity
    Binding sitei373 – 3731SubstrateBy similarity

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. polypeptide N-acetylgalactosaminyltransferase activity Source: UniProtKB-EC

    GO - Biological processi

    1. protein glycosylation Source: UniProtKB-UniPathway

    Keywords - Molecular functioni

    Glycosyltransferase, Transferase

    Keywords - Ligandi

    Lectin, Manganese, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_115606. O-linked glycosylation of mucins.
    UniPathwayiUPA00378.

    Protein family/group databases

    CAZyiCBM13. Carbohydrate-Binding Module Family 13.
    GT27. Glycosyltransferase Family 27.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Polypeptide N-acetylgalactosaminyltransferase-like 6 (EC:2.4.1.41)
    Alternative name(s):
    Polypeptide GalNAc transferase 17
    Short name:
    GalNAc-T17
    Short name:
    pp-GaNTase 17
    Protein-UDP acetylgalactosaminyltransferase 17
    Putative polypeptide N-acetylgalactosaminyltransferase 17
    UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 17
    Gene namesi
    Name:GALNTL6
    Synonyms:GALNT17
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:33844. GALNTL6.

    Subcellular locationi

    GO - Cellular componenti

    1. Golgi membrane Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164720162.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 601601Polypeptide N-acetylgalactosaminyltransferase-like 6PRO_0000325774Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi130 ↔ 360PROSITE-ProRule annotation
    Glycosylationi141 – 1411N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi351 ↔ 427PROSITE-ProRule annotation
    Disulfide bondi466 ↔ 483PROSITE-ProRule annotation
    Disulfide bondi518 ↔ 533PROSITE-ProRule annotation
    Disulfide bondi558 ↔ 573PROSITE-ProRule annotation
    Glycosylationi588 – 5881N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ49A17.
    PRIDEiQ49A17.

    Expressioni

    Gene expression databases

    ArrayExpressiQ49A17.
    BgeeiQ49A17.
    CleanExiHS_GALNTL6.
    GenevestigatoriQ49A17.

    Organism-specific databases

    HPAiHPA031019.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000385382.

    Structurei

    3D structure databases

    ProteinModelPortaliQ49A17.
    SMRiQ49A17. Positions 63-598.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 77CytoplasmicSequence Analysis
    Topological domaini29 – 601573LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei8 – 2821Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini453 – 585133Ricin B-type lectinPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni139 – 248110Catalytic subdomain AAdd
    BLAST
    Regioni306 – 36863Catalytic subdomain BAdd
    BLAST

    Domaini

    There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.By similarity
    The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.By similarity

    Sequence similaritiesi

    Contains 1 ricin B-type lectin domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG239675.
    HOGENOMiHOG000038227.
    HOVERGENiHBG051699.
    InParanoidiQ49A17.
    KOiK00710.
    OMAiAVNRKWF.
    OrthoDBiEOG7J9VP2.
    PhylomeDBiQ49A17.
    TreeFamiTF313267.

    Family and domain databases

    Gene3Di3.90.550.10. 1 hit.
    InterProiIPR001173. Glyco_trans_2-like.
    IPR029044. Nucleotide-diphossugar_trans.
    IPR000772. Ricin_B_lectin.
    [Graphical view]
    PfamiPF00535. Glycos_transf_2. 1 hit.
    PF00652. Ricin_B_lectin. 1 hit.
    [Graphical view]
    SMARTiSM00458. RICIN. 1 hit.
    [Graphical view]
    SUPFAMiSSF50370. SSF50370. 1 hit.
    SSF53448. SSF53448. 1 hit.
    PROSITEiPS50231. RICIN_B_LECTIN. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q49A17-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKRKQKRFLQ MTLLFTVALI FLPNVGLWSL YKDKHLVKSA EPGEQQTFPL    50
    GLGDGQFYSW TDGLRRKDWH DYESIQKEAM RSGKGEHGKP YPLTEEDHDD 100
    SAYRENGFNI FVSNNIALER SLPDIRHANC KHKMYLERLP NTSIIIPFHN 150
    EGWTSLLRTI HSIINRTPGS LIAEIILVDD FSEREHLKDK LEEYMARFSK 200
    VRIVRTKKRE GLIRTRLLGA SMARGEVLTF LDSHCEVNVN WLPPLLNQIA 250
    LNHKTIVCPM IDVIDHNHFG YEAQAGDAMR GAFDWEMYYK RIPIPPELQR 300
    ADPSDPFESP VMAGGLFAVD RKWFWELGGY DPGLEIWGGE QYEISFKVWM 350
    CGGEMFDVPC SRVGHIYRKY VPYKVPSGTS LARNLKRVAE TWMDEFAEYI 400
    YQRRPEYRHL STGDISAQKE LRKQLKCKDF KWFMAAVAWD VPKYYPPVEP 450
    PPAAWGEIRN VAANLCVDSK HGATGTELRL DICVKDGSER TWSHEQLFTF 500
    GWREDIRPGE PLHTRKFCFD AISHNSPVTL YDCHGMKGNQ LWGYRKDRTL 550
    FHPVSNSCMD CNPAEKKIFM ARCDPLSETQ QWIFEHINMT VLEKFNHHAN 600
    S 601
    Length:601
    Mass (Da):69,788
    Last modified:May 18, 2010 - v2
    Checksum:iDEFBE2E41DD2FC1D
    GO
    Isoform 2 (identifier: Q49A17-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-45: MKRKQKRFLQMTLLFTVALIFLPNVGLWSLYKDKHLVKSAEPGEQ → MRAKFRAGAGHQRNPSISADHGVHELVY

    Show »
    Length:584
    Mass (Da):67,589
    Checksum:i5A97ED40D9AB1E8F
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti83 – 831G → R in AAH47551. (PubMed:15489334)Curated
    Sequence conflicti250 – 2501A → P in AAH47551. (PubMed:15489334)Curated
    Sequence conflicti563 – 5631P → H in AAH47551. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4545MKRKQ…EPGEQ → MRAKFRAGAGHQRNPSISAD HGVHELVY in isoform 2. 1 PublicationVSP_032402Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ626725 mRNA. Translation: CAF25036.1.
    AC024706 Genomic DNA. No translation available.
    AC025561 Genomic DNA. No translation available.
    AC025821 Genomic DNA. No translation available.
    AC093803 Genomic DNA. No translation available.
    AC095045 Genomic DNA. No translation available.
    AC095063 Genomic DNA. No translation available.
    AC097496 Genomic DNA. No translation available.
    AC105285 Genomic DNA. No translation available.
    AC108064 Genomic DNA. No translation available.
    AC109520 Genomic DNA. No translation available.
    AC110776 Genomic DNA. No translation available.
    AC131952 Genomic DNA. No translation available.
    BC047551 mRNA. Translation: AAH47551.1.
    CCDSiCCDS34104.1. [Q49A17-1]
    RefSeqiNP_001030017.2. NM_001034845.2. [Q49A17-1]
    UniGeneiHs.386236.

    Genome annotation databases

    EnsembliENST00000506823; ENSP00000423313; ENSG00000174473. [Q49A17-1]
    ENST00000508122; ENSP00000423827; ENSG00000174473. [Q49A17-2]
    GeneIDi442117.
    KEGGihsa:442117.
    UCSCiuc003isv.3. human. [Q49A17-1]

    Polymorphism databases

    DMDMi296434516.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ626725 mRNA. Translation: CAF25036.1 .
    AC024706 Genomic DNA. No translation available.
    AC025561 Genomic DNA. No translation available.
    AC025821 Genomic DNA. No translation available.
    AC093803 Genomic DNA. No translation available.
    AC095045 Genomic DNA. No translation available.
    AC095063 Genomic DNA. No translation available.
    AC097496 Genomic DNA. No translation available.
    AC105285 Genomic DNA. No translation available.
    AC108064 Genomic DNA. No translation available.
    AC109520 Genomic DNA. No translation available.
    AC110776 Genomic DNA. No translation available.
    AC131952 Genomic DNA. No translation available.
    BC047551 mRNA. Translation: AAH47551.1 .
    CCDSi CCDS34104.1. [Q49A17-1 ]
    RefSeqi NP_001030017.2. NM_001034845.2. [Q49A17-1 ]
    UniGenei Hs.386236.

    3D structure databases

    ProteinModelPortali Q49A17.
    SMRi Q49A17. Positions 63-598.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000385382.

    Protein family/group databases

    CAZyi CBM13. Carbohydrate-Binding Module Family 13.
    GT27. Glycosyltransferase Family 27.

    Polymorphism databases

    DMDMi 296434516.

    Proteomic databases

    PaxDbi Q49A17.
    PRIDEi Q49A17.

    Protocols and materials databases

    DNASUi 442117.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000506823 ; ENSP00000423313 ; ENSG00000174473 . [Q49A17-1 ]
    ENST00000508122 ; ENSP00000423827 ; ENSG00000174473 . [Q49A17-2 ]
    GeneIDi 442117.
    KEGGi hsa:442117.
    UCSCi uc003isv.3. human. [Q49A17-1 ]

    Organism-specific databases

    CTDi 442117.
    GeneCardsi GC04P172735.
    HGNCi HGNC:33844. GALNTL6.
    HPAi HPA031019.
    neXtProti NX_Q49A17.
    PharmGKBi PA164720162.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG239675.
    HOGENOMi HOG000038227.
    HOVERGENi HBG051699.
    InParanoidi Q49A17.
    KOi K00710.
    OMAi AVNRKWF.
    OrthoDBi EOG7J9VP2.
    PhylomeDBi Q49A17.
    TreeFami TF313267.

    Enzyme and pathway databases

    UniPathwayi UPA00378 .
    Reactomei REACT_115606. O-linked glycosylation of mucins.

    Miscellaneous databases

    GenomeRNAii 442117.
    NextBioi 110727.
    PROi Q49A17.

    Gene expression databases

    ArrayExpressi Q49A17.
    Bgeei Q49A17.
    CleanExi HS_GALNTL6.
    Genevestigatori Q49A17.

    Family and domain databases

    Gene3Di 3.90.550.10. 1 hit.
    InterProi IPR001173. Glyco_trans_2-like.
    IPR029044. Nucleotide-diphossugar_trans.
    IPR000772. Ricin_B_lectin.
    [Graphical view ]
    Pfami PF00535. Glycos_transf_2. 1 hit.
    PF00652. Ricin_B_lectin. 1 hit.
    [Graphical view ]
    SMARTi SM00458. RICIN. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50370. SSF50370. 1 hit.
    SSF53448. SSF53448. 1 hit.
    PROSITEi PS50231. RICIN_B_LECTIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The GalNAc-transferase gene family."
      Bennett E.P.
      Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.

    Entry informationi

    Entry nameiGLTL6_HUMAN
    AccessioniPrimary (citable) accession number: Q49A17
    Secondary accession number(s): Q2L4S6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 18, 2008
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 80 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3