Reviewed,
UniProtKB/Swiss-Prot Q49A17 (GLTL6_HUMAN)
Last modified
October 13, 2009.
Version 37.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Polypeptide N-acetylgalactosaminyltransferase-like 6 EC=2.4.1.41 Alternative name(s): Putative polypeptide N-acetylgalactosaminyltransferase 17 Polypeptide GalNAc transferase 17 Short name=pp-GaNTase 17 Short name=GalNAc-T17 Protein-UDP acetylgalactosaminyltransferase 17 UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 17 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 601 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor By similarity. |
| Catalytic activity | UDP-N-acetyl-D-galactosamine + polypeptide = UDP + N-acetyl-D-galactosaminyl-polypeptide. |
| Cofactor | Manganese By similarity. Calcium By similarity. |
| Pathway | |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein By similarity. |
| Domain | There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding By similarity. The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity By similarity. |
| Sequence similarities | Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily. Contains 1 ricin B-type lectin domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal-anchor Transmembrane |
| Ligand | Calcium Lectin Manganese Metal-binding |
| Molecular function | Glycosyltransferase Transferase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Cellular component | Golgi apparatus Inferred from electronic annotation. Source: UniProtKB-KW integral to membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: UniProtKB-KW manganese ion bindingInferred from electronic annotation. Source: UniProtKB-KW polypeptide N-acetylgalactosaminyltransferase activityInferred from electronic annotation. Source: EC sugar bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q49A17-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q49A17-2) The sequence of this isoform differs from the canonical sequence as follows: 1-45: MKRKQKRFLQMTLLFTVALIFLPNVGLWSLYKDKHLVKSAEPGEQ → MRAKFRAGAGHQRNPSISADHGVHELVY |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 601 | 601 | Polypeptide N-acetylgalactosaminyltransferase-like 6 | PRO_0000325774 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 7 | 7 | Cytoplasmic Potential | ||||||||
| Transmembrane | 8 – 28 | 21 | Signal-anchor for type II membrane protein Potential | ||||||||
| Topological domain | 29 – 601 | 573 | Lumenal Potential | ||||||||
| Domain | 453 – 585 | 133 | Ricin B-type lectin | ||||||||
| Region | 139 – 248 | 110 | Catalytic subdomain A | ||||||||
| Region | 306 – 368 | 63 | Catalytic subdomain B | ||||||||
Sites | |||||||||||
| Metal binding | 232 | 1 | Manganese By similarity | ||||||||
| Metal binding | 234 | 1 | Manganese By similarity | ||||||||
| Metal binding | 365 | 1 | Manganese By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 141 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 588 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 130 ↔ 360 | By similarity | |||||||||
| Disulfide bond | 351 ↔ 427 | By similarity | |||||||||
| Disulfide bond | 466 ↔ 483 | By similarity | |||||||||
| Disulfide bond | 518 ↔ 533 | By similarity | |||||||||
| Disulfide bond | 558 ↔ 573 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 45 | 45 | MKRKQ…EPGEQ → MRAKFRAGAGHQRNPSISAD HGVHELVY in isoform 2. | VSP_032402 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 83 | 1 | R → G in CAF25036. Ref.1 | ||||||||
| Sequence conflict | 250 | 1 | P → A in CAF25036. Ref.1 | ||||||||
| Sequence conflict | 563 | 1 | H → P in CAF25036. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The GalNAc-transferase gene family." Bennett E.P. Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AJ626725 mRNA. Translation: CAF25036.1. BC047551 mRNA. Translation: AAH47551.1. | |
| IPI | IPI00454894. IPI00888755. |
| RefSeq | NP_001030017.2. |
| UniGene | Hs.386236 |
3D structure databases | |
| SMR | Q49A17. Positions 63-598. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q49A17. |
Protein family/group databases | |
| CAZy | CBM13. Carbohydrate-Binding Module Family 13. GT27. Glycosyltransferase Family 27. |
Proteomic databases | |
| PRIDE | Q49A17. |
Genome annotation databases | |
| Ensembl | ENST00000308120; ENSP00000308828; ENSG00000174473; Homo sapiens. [Genome view] ENST00000404275; ENSP00000385382; ENSG00000174473; Homo sapiens. [Genome view] ENST00000457021; ENSP00000392006; ENSG00000174473; Homo sapiens. [Genome view] |
| GeneID | 442117. |
| KEGG | hsa:442117. |
| UCSC | uc003isv.1. human. |
Organism-specific databases | |
| CTD | 442117. |
| GeneCards | GC04P172972. |
| HGNC | HGNC:33844. GALNTL6. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q49A17. |
| HOVERGEN | Q49A17. |
Enzyme and pathway databases | |
| BRENDA | 2.4.1.41. 247. |
Gene expression databases | |
| ArrayExpress | Q49A17. |
| Bgee | Q49A17. |
| CleanEx | HS_GALNTL6. |
| Genevestigator | Q49A17. |
Family and domain databases | |
| InterPro | IPR001173. Glyco_trans_2. IPR000772. Ricin_B_lectin. [Graphical view] |
| Pfam | PF00535. Glycos_transf_2. 1 hit. PF00652. Ricin_B_lectin. 1 hit. [Graphical view] |
| SMART | SM00458. RICIN. 1 hit. [Graphical view] |
| PROSITE | PS50231. RICIN_B_LECTIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 110727. |
Entry information
| Entry name | GLTL6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q49A17 Secondary accession number(s): Q2L4S6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with


