Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q49A17

- GLTL6_HUMAN

UniProt

Q49A17 - GLTL6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Polypeptide N-acetylgalactosaminyltransferase-like 6

Gene

GALNTL6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.By similarity

Catalytic activityi

UDP-N-acetyl-alpha-D-galactosamine + polypeptide = UDP + N-acetyl-alpha-D-galactosaminyl-polypeptide.

Cofactori

Manganese.By similarity

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei180 – 1801SubstrateBy similarity
Binding sitei209 – 2091SubstrateBy similarity
Metal bindingi232 – 2321ManganeseBy similarity
Binding sitei233 – 2331SubstrateBy similarity
Metal bindingi234 – 2341ManganeseBy similarity
Binding sitei337 – 3371SubstrateBy similarity
Metal bindingi365 – 3651ManganeseBy similarity
Binding sitei368 – 3681SubstrateBy similarity
Binding sitei373 – 3731SubstrateBy similarity

GO - Molecular functioni

  1. carbohydrate binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW
  3. polypeptide N-acetylgalactosaminyltransferase activity Source: UniProtKB-EC

GO - Biological processi

  1. protein glycosylation Source: UniProtKB-UniPathway
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Keywords - Ligandi

Lectin, Manganese, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_115606. O-linked glycosylation of mucins.
UniPathwayiUPA00378.

Protein family/group databases

CAZyiCBM13. Carbohydrate-Binding Module Family 13.
GT27. Glycosyltransferase Family 27.

Names & Taxonomyi

Protein namesi
Recommended name:
Polypeptide N-acetylgalactosaminyltransferase-like 6 (EC:2.4.1.41)
Alternative name(s):
Polypeptide GalNAc transferase 17
Short name:
GalNAc-T17
Short name:
pp-GaNTase 17
Protein-UDP acetylgalactosaminyltransferase 17
Putative polypeptide N-acetylgalactosaminyltransferase 17
UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 17
Gene namesi
Name:GALNTL6
Synonyms:GALNT17
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:33844. GALNTL6.

Subcellular locationi

GO - Cellular componenti

  1. Golgi apparatus Source: UniProtKB-KW
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164720162.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 601601Polypeptide N-acetylgalactosaminyltransferase-like 6PRO_0000325774Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi130 ↔ 360PROSITE-ProRule annotation
Glycosylationi141 – 1411N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi351 ↔ 427PROSITE-ProRule annotation
Disulfide bondi466 ↔ 483PROSITE-ProRule annotation
Disulfide bondi518 ↔ 533PROSITE-ProRule annotation
Disulfide bondi558 ↔ 573PROSITE-ProRule annotation
Glycosylationi588 – 5881N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ49A17.
PaxDbiQ49A17.
PRIDEiQ49A17.

Expressioni

Gene expression databases

BgeeiQ49A17.
CleanExiHS_GALNTL6.
ExpressionAtlasiQ49A17. baseline.
GenevestigatoriQ49A17.

Organism-specific databases

HPAiHPA031019.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000385382.

Structurei

3D structure databases

ProteinModelPortaliQ49A17.
SMRiQ49A17. Positions 63-598.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 77CytoplasmicSequence Analysis
Topological domaini29 – 601573LumenalSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei8 – 2821Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini453 – 585133Ricin B-type lectinPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni139 – 248110Catalytic subdomain AAdd
BLAST
Regioni306 – 36863Catalytic subdomain BAdd
BLAST

Domaini

There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.By similarity
The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.By similarity

Sequence similaritiesi

Contains 1 ricin B-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG239675.
GeneTreeiENSGT00760000118828.
HOGENOMiHOG000038227.
HOVERGENiHBG051699.
InParanoidiQ49A17.
KOiK00710.
OMAiAVNRKWF.
OrthoDBiEOG7J9VP2.
PhylomeDBiQ49A17.
TreeFamiTF313267.

Family and domain databases

Gene3Di3.90.550.10. 1 hit.
InterProiIPR001173. Glyco_trans_2-like.
IPR029044. Nucleotide-diphossugar_trans.
IPR000772. Ricin_B_lectin.
[Graphical view]
PfamiPF00535. Glycos_transf_2. 1 hit.
PF00652. Ricin_B_lectin. 1 hit.
[Graphical view]
SMARTiSM00458. RICIN. 1 hit.
[Graphical view]
SUPFAMiSSF50370. SSF50370. 1 hit.
SSF53448. SSF53448. 1 hit.
PROSITEiPS50231. RICIN_B_LECTIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q49A17-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKRKQKRFLQ MTLLFTVALI FLPNVGLWSL YKDKHLVKSA EPGEQQTFPL
60 70 80 90 100
GLGDGQFYSW TDGLRRKDWH DYESIQKEAM RSGKGEHGKP YPLTEEDHDD
110 120 130 140 150
SAYRENGFNI FVSNNIALER SLPDIRHANC KHKMYLERLP NTSIIIPFHN
160 170 180 190 200
EGWTSLLRTI HSIINRTPGS LIAEIILVDD FSEREHLKDK LEEYMARFSK
210 220 230 240 250
VRIVRTKKRE GLIRTRLLGA SMARGEVLTF LDSHCEVNVN WLPPLLNQIA
260 270 280 290 300
LNHKTIVCPM IDVIDHNHFG YEAQAGDAMR GAFDWEMYYK RIPIPPELQR
310 320 330 340 350
ADPSDPFESP VMAGGLFAVD RKWFWELGGY DPGLEIWGGE QYEISFKVWM
360 370 380 390 400
CGGEMFDVPC SRVGHIYRKY VPYKVPSGTS LARNLKRVAE TWMDEFAEYI
410 420 430 440 450
YQRRPEYRHL STGDISAQKE LRKQLKCKDF KWFMAAVAWD VPKYYPPVEP
460 470 480 490 500
PPAAWGEIRN VAANLCVDSK HGATGTELRL DICVKDGSER TWSHEQLFTF
510 520 530 540 550
GWREDIRPGE PLHTRKFCFD AISHNSPVTL YDCHGMKGNQ LWGYRKDRTL
560 570 580 590 600
FHPVSNSCMD CNPAEKKIFM ARCDPLSETQ QWIFEHINMT VLEKFNHHAN

S
Length:601
Mass (Da):69,788
Last modified:May 18, 2010 - v2
Checksum:iDEFBE2E41DD2FC1D
GO
Isoform 2 (identifier: Q49A17-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MKRKQKRFLQMTLLFTVALIFLPNVGLWSLYKDKHLVKSAEPGEQ → MRAKFRAGAGHQRNPSISADHGVHELVY

Show »
Length:584
Mass (Da):67,589
Checksum:i5A97ED40D9AB1E8F
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti83 – 831G → R in AAH47551. (PubMed:15489334)Curated
Sequence conflicti250 – 2501A → P in AAH47551. (PubMed:15489334)Curated
Sequence conflicti563 – 5631P → H in AAH47551. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4545MKRKQ…EPGEQ → MRAKFRAGAGHQRNPSISAD HGVHELVY in isoform 2. 1 PublicationVSP_032402Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ626725 mRNA. Translation: CAF25036.1.
AC024706 Genomic DNA. No translation available.
AC025561 Genomic DNA. No translation available.
AC025821 Genomic DNA. No translation available.
AC093803 Genomic DNA. No translation available.
AC095045 Genomic DNA. No translation available.
AC095063 Genomic DNA. No translation available.
AC097496 Genomic DNA. No translation available.
AC105285 Genomic DNA. No translation available.
AC108064 Genomic DNA. No translation available.
AC109520 Genomic DNA. No translation available.
AC110776 Genomic DNA. No translation available.
AC131952 Genomic DNA. No translation available.
BC047551 mRNA. Translation: AAH47551.1.
CCDSiCCDS34104.1. [Q49A17-1]
RefSeqiNP_001030017.2. NM_001034845.2. [Q49A17-1]
UniGeneiHs.386236.

Genome annotation databases

EnsembliENST00000506823; ENSP00000423313; ENSG00000174473. [Q49A17-1]
ENST00000508122; ENSP00000423827; ENSG00000174473. [Q49A17-2]
GeneIDi442117.
KEGGihsa:442117.
UCSCiuc003isv.3. human. [Q49A17-1]

Polymorphism databases

DMDMi296434516.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ626725 mRNA. Translation: CAF25036.1 .
AC024706 Genomic DNA. No translation available.
AC025561 Genomic DNA. No translation available.
AC025821 Genomic DNA. No translation available.
AC093803 Genomic DNA. No translation available.
AC095045 Genomic DNA. No translation available.
AC095063 Genomic DNA. No translation available.
AC097496 Genomic DNA. No translation available.
AC105285 Genomic DNA. No translation available.
AC108064 Genomic DNA. No translation available.
AC109520 Genomic DNA. No translation available.
AC110776 Genomic DNA. No translation available.
AC131952 Genomic DNA. No translation available.
BC047551 mRNA. Translation: AAH47551.1 .
CCDSi CCDS34104.1. [Q49A17-1 ]
RefSeqi NP_001030017.2. NM_001034845.2. [Q49A17-1 ]
UniGenei Hs.386236.

3D structure databases

ProteinModelPortali Q49A17.
SMRi Q49A17. Positions 63-598.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000385382.

Protein family/group databases

CAZyi CBM13. Carbohydrate-Binding Module Family 13.
GT27. Glycosyltransferase Family 27.

Polymorphism databases

DMDMi 296434516.

Proteomic databases

MaxQBi Q49A17.
PaxDbi Q49A17.
PRIDEi Q49A17.

Protocols and materials databases

DNASUi 442117.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000506823 ; ENSP00000423313 ; ENSG00000174473 . [Q49A17-1 ]
ENST00000508122 ; ENSP00000423827 ; ENSG00000174473 . [Q49A17-2 ]
GeneIDi 442117.
KEGGi hsa:442117.
UCSCi uc003isv.3. human. [Q49A17-1 ]

Organism-specific databases

CTDi 442117.
GeneCardsi GC04P172735.
HGNCi HGNC:33844. GALNTL6.
HPAi HPA031019.
neXtProti NX_Q49A17.
PharmGKBi PA164720162.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG239675.
GeneTreei ENSGT00760000118828.
HOGENOMi HOG000038227.
HOVERGENi HBG051699.
InParanoidi Q49A17.
KOi K00710.
OMAi AVNRKWF.
OrthoDBi EOG7J9VP2.
PhylomeDBi Q49A17.
TreeFami TF313267.

Enzyme and pathway databases

UniPathwayi UPA00378 .
Reactomei REACT_115606. O-linked glycosylation of mucins.

Miscellaneous databases

GenomeRNAii 442117.
NextBioi 110727.
PROi Q49A17.

Gene expression databases

Bgeei Q49A17.
CleanExi HS_GALNTL6.
ExpressionAtlasi Q49A17. baseline.
Genevestigatori Q49A17.

Family and domain databases

Gene3Di 3.90.550.10. 1 hit.
InterProi IPR001173. Glyco_trans_2-like.
IPR029044. Nucleotide-diphossugar_trans.
IPR000772. Ricin_B_lectin.
[Graphical view ]
Pfami PF00535. Glycos_transf_2. 1 hit.
PF00652. Ricin_B_lectin. 1 hit.
[Graphical view ]
SMARTi SM00458. RICIN. 1 hit.
[Graphical view ]
SUPFAMi SSF50370. SSF50370. 1 hit.
SSF53448. SSF53448. 1 hit.
PROSITEi PS50231. RICIN_B_LECTIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The GalNAc-transferase gene family."
    Bennett E.P.
    Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiGLTL6_HUMAN
AccessioniPrimary (citable) accession number: Q49A17
Secondary accession number(s): Q2L4S6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: May 18, 2010
Last modified: October 29, 2014
This is version 81 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3