Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q499E6

- CA109_MOUSE

UniProt

Q499E6 - CA109_MOUSE

Protein

Uncharacterized protein C1orf109 homolog

Gene
N/A
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 1 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 53 (01 Oct 2014)
      Sequence version 1 (13 Sep 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Uncharacterized protein C1orf109 homolog
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Unplaced

    Organism-specific databases

    MGIiMGI:3041172. 9930104L06Rik.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 217217Uncharacterized protein C1orf109 homologPRO_0000274383Add
    BLAST

    Proteomic databases

    MaxQBiQ499E6.
    PRIDEiQ499E6.

    PTM databases

    PhosphoSiteiQ499E6.

    Expressioni

    Gene expression databases

    CleanExiMM_9930104L06RIK.
    GenevestigatoriQ499E6.

    Interactioni

    Protein-protein interaction databases

    IntActiQ499E6. 1 interaction.

    Family & Domainsi

    Phylogenomic databases

    eggNOGiNOG45850.
    HOVERGENiHBG080964.
    InParanoidiQ499E6.
    PhylomeDBiQ499E6.

    Family and domain databases

    InterProiIPR029159. CK2S.
    [Graphical view]
    PfamiPF15011. CK2S. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q499E6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAHDQPLLVV QEALRKCFPV VEEQQNLWQS TLQDCSPLLS SLSNLAEQLQ    50
    AAQSLRFEDV PALRPFPDLQ ERLRRKQLEA GDVVLDKLAE RLATLLKVRN 100
    TINSHVEQVF QAYEQHAAVL DIDTVLRPSV VSPSVADMLE WLQDIDRHYG 150
    SSYLKRKYLL SSIHWGDLAS IQALPKAWDQ ISENECQTLV SDVLVSVSFF 200
    LEEPGGCAAS GDLEHHS 217
    Length:217
    Mass (Da):24,442
    Last modified:September 13, 2005 - v1
    Checksum:i891D3EE1FC57426E
    GO
    Isoform 2 (identifier: Q499E6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         151-217: SSYLKRKYLLSSIHWGDLASIQALPKAWDQISENECQTLVSDVLVSVSFFLEEPGGCAASGDLEHHS → GSYPSSAS

    Show »
    Length:158
    Mass (Da):17,831
    Checksum:iE2A715FBD47406E4
    GO
    Isoform 3 (identifier: Q499E6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         93-217: Missing.

    Show »
    Length:92
    Mass (Da):10,522
    Checksum:i78188D9B7054B2FE
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti62 – 621A → S in BC117984. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei93 – 217125Missing in isoform 3. 2 PublicationsVSP_022735Add
    BLAST
    Alternative sequencei151 – 21767SSYLK…LEHHS → GSYPSSAS in isoform 2. 1 PublicationVSP_022736Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK037053 mRNA. Translation: BAC29685.1.
    AK158126 mRNA. Translation: BAE34372.1.
    AK160978 mRNA. Translation: BAE36127.1.
    BC099946 mRNA. Translation: AAH99946.1.
    BC117984 mRNA. No translation available.
    RefSeqiNP_808241.2. NM_177573.3. [Q499E6-1]
    XP_006502949.1. XM_006502886.1. [Q499E6-1]
    UniGeneiMm.266907.

    Genome annotation databases

    GeneIDi194268.
    KEGGimmu:194268.
    UCSCiuc008url.1. mouse. [Q499E6-1]
    uc008urm.1. mouse. [Q499E6-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK037053 mRNA. Translation: BAC29685.1 .
    AK158126 mRNA. Translation: BAE34372.1 .
    AK160978 mRNA. Translation: BAE36127.1 .
    BC099946 mRNA. Translation: AAH99946.1 .
    BC117984 mRNA. No translation available.
    RefSeqi NP_808241.2. NM_177573.3. [Q499E6-1 ]
    XP_006502949.1. XM_006502886.1. [Q499E6-1 ]
    UniGenei Mm.266907.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q499E6. 1 interaction.

    PTM databases

    PhosphoSitei Q499E6.

    Proteomic databases

    MaxQBi Q499E6.
    PRIDEi Q499E6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 194268.
    KEGGi mmu:194268.
    UCSCi uc008url.1. mouse. [Q499E6-1 ]
    uc008urm.1. mouse. [Q499E6-3 ]

    Organism-specific databases

    MGIi MGI:3041172. 9930104L06Rik.

    Phylogenomic databases

    eggNOGi NOG45850.
    HOVERGENi HBG080964.
    InParanoidi Q499E6.
    PhylomeDBi Q499E6.

    Miscellaneous databases

    NextBioi 371560.

    Gene expression databases

    CleanExi MM_9930104L06RIK.
    Genevestigatori Q499E6.

    Family and domain databases

    InterProi IPR029159. CK2S.
    [Graphical view ]
    Pfami PF15011. CK2S. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
      Strain: C57BL/6J.
      Tissue: Inner ear.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Strain: CD-1.
      Tissue: Neural stem cell.

    Entry informationi

    Entry nameiCA109_MOUSE
    AccessioniPrimary (citable) accession number: Q499E6
    Secondary accession number(s): Q148T1, Q3TU44, Q8BI05
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 6, 2007
    Last sequence update: September 13, 2005
    Last modified: October 1, 2014
    This is version 53 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3