SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q499E6

- CA109_MOUSE

UniProt

Q499E6 - CA109_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Uncharacterized protein C1orf109 homolog

Gene
N/A
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 2 out of 5 - Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C1orf109 homolog
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Unplaced

Organism-specific databases

MGIiMGI:3041172. 9930104L06Rik.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 217217Uncharacterized protein C1orf109 homologPRO_0000274383Add
BLAST

Proteomic databases

MaxQBiQ499E6.
PRIDEiQ499E6.

PTM databases

PhosphoSiteiQ499E6.

Expressioni

Gene expression databases

CleanExiMM_9930104L06RIK.
GenevestigatoriQ499E6.

Interactioni

Protein-protein interaction databases

IntActiQ499E6. 1 interaction.

Family & Domainsi

Phylogenomic databases

eggNOGiNOG45850.
HOVERGENiHBG080964.
InParanoidiQ499E6.
PhylomeDBiQ499E6.

Family and domain databases

InterProiIPR029159. CK2S.
[Graphical view]
PfamiPF15011. CK2S. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q499E6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAHDQPLLVV QEALRKCFPV VEEQQNLWQS TLQDCSPLLS SLSNLAEQLQ    50
AAQSLRFEDV PALRPFPDLQ ERLRRKQLEA GDVVLDKLAE RLATLLKVRN 100
TINSHVEQVF QAYEQHAAVL DIDTVLRPSV VSPSVADMLE WLQDIDRHYG 150
SSYLKRKYLL SSIHWGDLAS IQALPKAWDQ ISENECQTLV SDVLVSVSFF 200
LEEPGGCAAS GDLEHHS 217
Length:217
Mass (Da):24,442
Last modified:September 13, 2005 - v1
Checksum:i891D3EE1FC57426E
GO
Isoform 2 (identifier: Q499E6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     151-217: SSYLKRKYLLSSIHWGDLASIQALPKAWDQISENECQTLVSDVLVSVSFFLEEPGGCAASGDLEHHS → GSYPSSAS

Show »
Length:158
Mass (Da):17,831
Checksum:iE2A715FBD47406E4
GO
Isoform 3 (identifier: Q499E6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-217: Missing.

Show »
Length:92
Mass (Da):10,522
Checksum:i78188D9B7054B2FE
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei93 – 217125Missing in isoform 3. VSP_022735Add
BLAST
Alternative sequencei151 – 21767SSYLK…LEHHS → GSYPSSAS in isoform 2. VSP_022736Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti62 – 621A → S in BC117984. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK037053 mRNA. Translation: BAC29685.1.
AK158126 mRNA. Translation: BAE34372.1.
AK160978 mRNA. Translation: BAE36127.1.
BC099946 mRNA. Translation: AAH99946.1.
BC117984 mRNA. No translation available.
RefSeqiNP_808241.2. NM_177573.3. [Q499E6-1]
XP_006502949.1. XM_006502886.1. [Q499E6-1]
UniGeneiMm.266907.

Genome annotation databases

GeneIDi194268.
KEGGimmu:194268.
UCSCiuc008url.1. mouse. [Q499E6-1]
uc008urm.1. mouse. [Q499E6-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK037053 mRNA. Translation: BAC29685.1 .
AK158126 mRNA. Translation: BAE34372.1 .
AK160978 mRNA. Translation: BAE36127.1 .
BC099946 mRNA. Translation: AAH99946.1 .
BC117984 mRNA. No translation available.
RefSeqi NP_808241.2. NM_177573.3. [Q499E6-1 ]
XP_006502949.1. XM_006502886.1. [Q499E6-1 ]
UniGenei Mm.266907.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q499E6. 1 interaction.

PTM databases

PhosphoSitei Q499E6.

Proteomic databases

MaxQBi Q499E6.
PRIDEi Q499E6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 194268.
KEGGi mmu:194268.
UCSCi uc008url.1. mouse. [Q499E6-1 ]
uc008urm.1. mouse. [Q499E6-3 ]

Organism-specific databases

MGIi MGI:3041172. 9930104L06Rik.

Phylogenomic databases

eggNOGi NOG45850.
HOVERGENi HBG080964.
InParanoidi Q499E6.
PhylomeDBi Q499E6.

Miscellaneous databases

NextBioi 371560.

Gene expression databases

CleanExi MM_9930104L06RIK.
Genevestigatori Q499E6.

Family and domain databases

InterProi IPR029159. CK2S.
[Graphical view ]
Pfami PF15011. CK2S. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Strain: C57BL/6J.
    Tissue: Inner ear.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Strain: CD-1.
    Tissue: Neural stem cell.

Entry informationi

Entry nameiCA109_MOUSE
AccessioniPrimary (citable) accession number: Q499E6
Secondary accession number(s): Q148T1, Q3TU44, Q8BI05
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: September 13, 2005
Last modified: June 11, 2014
This is version 52 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi