Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier family 25 member 40

Gene

Slc25a40

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 25 member 40
Gene namesi
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 4

Organism-specific databases

RGDi1308774. Slc25a40.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei20 – 40Helical; Name=1Sequence analysisAdd BLAST21
Transmembranei104 – 124Helical; Name=2Sequence analysisAdd BLAST21
Transmembranei146 – 166Helical; Name=3Sequence analysisAdd BLAST21
Transmembranei200 – 221Helical; Name=4Sequence analysisAdd BLAST22
Transmembranei240 – 260Helical; Name=5Sequence analysisAdd BLAST21
Transmembranei299 – 319Helical; Name=6Sequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002918111 – 337Solute carrier family 25 member 40Add BLAST337

Proteomic databases

PaxDbiQ498U3.
PRIDEiQ498U3.

Expressioni

Tissue specificityi

Widely expressed at low level.1 Publication

Gene expression databases

BgeeiENSRNOG00000022837.

Interactioni

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000058058.

Structurei

3D structure databases

ProteinModelPortaliQ498U3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati14 – 132Solcar 1Add BLAST119
Repeati140 – 224Solcar 2Add BLAST85
Repeati234 – 328Solcar 3Add BLAST95

Sequence similaritiesi

Contains 3 Solcar repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0761. Eukaryota.
ENOG410XQVP. LUCA.
GeneTreeiENSGT00790000123051.
HOGENOMiHOG000214473.
HOVERGENiHBG011439.
InParanoidiQ498U3.
KOiK15119.
OMAiYWTTYET.
OrthoDBiEOG091G07QQ.
PhylomeDBiQ498U3.

Family and domain databases

Gene3Di1.50.40.10. 1 hit.
InterProiIPR002067. Mit_carrier.
IPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamiPF00153. Mito_carr. 3 hits.
[Graphical view]
PRINTSiPR00926. MITOCARRIER.
SUPFAMiSSF103506. SSF103506. 2 hits.
PROSITEiPS50920. SOLCAR. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q498U3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPETEGPPP TIQVTPLQQM MASCAGAVVT SLMVTPLDVV KIRLQAQNNP
60 70 80 90 100
FPKGKCFLYS NGLMDHICIC EEESKKAWYK KPGNFHGTLD AFLKIVRNEG
110 120 130 140 150
IKSLWSGLPP TLVMAVPATV IYFTCYEQLS TFLKTKLGEN ETRIPIVAGI
160 170 180 190 200
VARFGAVTMI SPLELIRTKM QSKTFSYKEL YQIVSMKVSE DGWISLWKGW
210 220 230 240 250
APTILRDVPF SAMYWYNYEN LRRWLCEKSD LYESTFMINF TAGALSGSFA
260 270 280 290 300
AVATLPFDVV KTQKQTQLWT HEYCKFPEPL DMSTWSIMKN IVADRGFSGL
310 320 330
FTGLIPRLVK IVPACAIMIS SYELGKGFFQ QQNVESR
Length:337
Mass (Da):38,061
Last modified:June 26, 2007 - v2
Checksum:i18DE77DB66F661ED
GO
Isoform 2 (identifier: Q498U3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-337: LIPRLVKIVPACAIMISSYELGKGFFQQQNVESR → ICLIKLSRLE...CTQCAQNIVK

Note: No experimental confirmation available.
Show »
Length:367
Mass (Da):41,021
Checksum:iC48783A55B82BE98
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_026244304 – 337LIPRL…NVESR → ICLIKLSRLERCSAAKSIGC SSRGSRLISQHPPGNLDLSI TPVPGNLAPSPRHTCTQCAQ NIVK in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AABR03033761 Genomic DNA. No translation available.
BC100071 mRNA. Translation: AAI00072.1.
RefSeqiNP_001032263.1. NM_001037186.1. [Q498U3-2]
UniGeneiRn.204764.

Genome annotation databases

EnsembliENSRNOT00000030352; ENSRNOP00000029371; ENSRNOG00000022837. [Q498U3-1]
ENSRNOT00000061342; ENSRNOP00000058058; ENSRNOG00000022837. [Q498U3-2]
GeneIDi296813.
KEGGirno:296813.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AABR03033761 Genomic DNA. No translation available.
BC100071 mRNA. Translation: AAI00072.1.
RefSeqiNP_001032263.1. NM_001037186.1. [Q498U3-2]
UniGeneiRn.204764.

3D structure databases

ProteinModelPortaliQ498U3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000058058.

Proteomic databases

PaxDbiQ498U3.
PRIDEiQ498U3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000030352; ENSRNOP00000029371; ENSRNOG00000022837. [Q498U3-1]
ENSRNOT00000061342; ENSRNOP00000058058; ENSRNOG00000022837. [Q498U3-2]
GeneIDi296813.
KEGGirno:296813.

Organism-specific databases

CTDi55972.
RGDi1308774. Slc25a40.

Phylogenomic databases

eggNOGiKOG0761. Eukaryota.
ENOG410XQVP. LUCA.
GeneTreeiENSGT00790000123051.
HOGENOMiHOG000214473.
HOVERGENiHBG011439.
InParanoidiQ498U3.
KOiK15119.
OMAiYWTTYET.
OrthoDBiEOG091G07QQ.
PhylomeDBiQ498U3.

Miscellaneous databases

PROiQ498U3.

Gene expression databases

BgeeiENSRNOG00000022837.

Family and domain databases

Gene3Di1.50.40.10. 1 hit.
InterProiIPR002067. Mit_carrier.
IPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamiPF00153. Mito_carr. 3 hits.
[Graphical view]
PRINTSiPR00926. MITOCARRIER.
SUPFAMiSSF103506. SSF103506. 2 hits.
PROSITEiPS50920. SOLCAR. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiS2540_RAT
AccessioniPrimary (citable) accession number: Q498U3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: June 26, 2007
Last modified: November 30, 2016
This is version 80 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.