Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier family 22 member 16

Gene

Slc22a16

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

High affinity carnitine transporter; the uptake is partially sodium-ion dependent. Thought to mediate the L-carnitine secretion mechanism from testis epididymal epithelium into the lumen which is involved in the maturation of spermatozoa. Also transports organic cations such as tetraethylammonium (TEA) and doxorubicin. The uptake of TEA is inhibited by various organic cations. The uptake of doxorubicin is sodium-independent (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Ion transport, Spermatogenesis, Transport

Enzyme and pathway databases

ReactomeiR-MMU-549127. Organic cation transport.

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 22 member 16
Alternative name(s):
Carnitine transporter 2
Short name:
CT2
Gene namesi
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:1918090. Slc22a16.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei19 – 39HelicalSequence analysisAdd BLAST21
Transmembranei156 – 176HelicalSequence analysisAdd BLAST21
Transmembranei190 – 210HelicalSequence analysisAdd BLAST21
Transmembranei214 – 234HelicalSequence analysisAdd BLAST21
Transmembranei244 – 264HelicalSequence analysisAdd BLAST21
Transmembranei268 – 288HelicalSequence analysisAdd BLAST21
Transmembranei356 – 376HelicalSequence analysisAdd BLAST21
Transmembranei389 – 409HelicalSequence analysisAdd BLAST21
Transmembranei417 – 437HelicalSequence analysisAdd BLAST21
Transmembranei445 – 465HelicalSequence analysisAdd BLAST21
Transmembranei475 – 495HelicalSequence analysisAdd BLAST21
Transmembranei501 – 521HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003189921 – 649Solute carrier family 22 member 16Add BLAST649

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi65N-linked (GlcNAc...)Sequence analysis1
Glycosylationi108N-linked (GlcNAc...)Sequence analysis1
Glycosylationi315N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ497L8.
PRIDEiQ497L8.

PTM databases

PhosphoSitePlusiQ497L8.

Expressioni

Gene expression databases

BgeeiENSMUSG00000019834.
ExpressionAtlasiQ497L8. baseline and differential.
GenevisibleiQ497L8. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000077428.

Structurei

3D structure databases

ProteinModelPortaliQ497L8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0255. Eukaryota.
COG0477. LUCA.
GeneTreeiENSGT00760000118852.
HOGENOMiHOG000060147.
HOVERGENiHBG108436.
InParanoidiQ497L8.
KOiK08212.
OMAiPAYVIAC.
OrthoDBiEOG091G03V1.
PhylomeDBiQ497L8.
TreeFamiTF315847.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR020846. MFS_dom.
IPR005828. MFS_sugar_transport-like.
[Graphical view]
PfamiPF00083. Sugar_tr. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q497L8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESCNVELIF DHIGHFGRFQ IVLYLICAYQ SLSCGIHYLS SVFLSIIPEH
60 70 80 90 100
ACKPPGMVRK AVFHNVSAWR LEDILALRSP EHKDHIMVEL QDGEIWELTR
110 120 130 140 150
CSRTWRENTS HLGYEYSGYK HDSPCFDGYV YDQSKWRNSA VRNFNLVCDQ
160 170 180 190 200
KWYARMIQPL IIFGVMLGSI TFSYLSDRFG RRMALWCTSI GVFFFGIASL
210 220 230 240 250
FIFDYLSFMI TRFFLVMASS GYFVVVFVYV MEIIGKKART WASIHLNTFF
260 270 280 290 300
AIGAMLVALA SYLLKTWWLY QIILCIVTTP FILCCWMLPE TPFWLLSEGR
310 320 330 340 350
YKEAQGTVDT MAVWNKSSSC DLVELLSLDV TRSHNKSPHS IRKHRLADLF
360 370 380 390 400
HNLDVAKMTL IVWLDWFTAN LGYYMFGKEV IRRKENEPLY LLLVGAMEIP
410 420 430 440 450
AYICLCIWLK RVGRRKTMLL FLLVSSLTCM LHVVMPSDYK TAKRMVALLV
460 470 480 490 500
KSVISSVFAF IYLYTAELYP TTVRCLAVGS SNMVSHVSSI FIPFTSHFSK
510 520 530 540 550
VWIFLPQILF GILAILSGLL SLKLPETQDT PMKSTWETTE QQVPENKDSL
560 570 580 590 600
GEGPPDSFER WDSSRALSFA ERWGLSRASP DAEKWGSGRV PPDAGKWGAG
610 620 630 640
IAPPVTERGA SGRASLEDES GGSGRAPPEK NTEMENEIEN MKVSNLGGF
Length:649
Mass (Da):73,933
Last modified:September 13, 2005 - v1
Checksum:i94BF1C8E7C6733FE
GO
Isoform 2 (identifier: Q497L8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-18: MESCNVELIFDHIGHFGR → MHKSGQQPMTWLVLLSIGHRRRRTLLGLGRCRQYSHPFG

Show »
Length:670
Mass (Da):76,404
Checksum:i4547BE49B65213A7
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0313391 – 18MESCN…GHFGR → MHKSGQQPMTWLVLLSIGHR RRRTLLGLGRCRQYSHPFG in isoform 2. 1 PublicationAdd BLAST18

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ164804 mRNA. Translation: ABA10822.1.
DQ164805 mRNA. Translation: ABA10823.1.
BC100473 mRNA. Translation: AAI00474.1.
CCDSiCCDS23796.1. [Q497L8-1]
RefSeqiNP_081848.1. NM_027572.1. [Q497L8-1]
UniGeneiMm.332570.

Genome annotation databases

EnsembliENSMUST00000019978; ENSMUSP00000019978; ENSMUSG00000019834. [Q497L8-2]
ENSMUST00000078314; ENSMUSP00000077428; ENSMUSG00000019834. [Q497L8-1]
GeneIDi70840.
KEGGimmu:70840.
UCSCiuc007ewz.1. mouse. [Q497L8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ164804 mRNA. Translation: ABA10822.1.
DQ164805 mRNA. Translation: ABA10823.1.
BC100473 mRNA. Translation: AAI00474.1.
CCDSiCCDS23796.1. [Q497L8-1]
RefSeqiNP_081848.1. NM_027572.1. [Q497L8-1]
UniGeneiMm.332570.

3D structure databases

ProteinModelPortaliQ497L8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000077428.

PTM databases

PhosphoSitePlusiQ497L8.

Proteomic databases

PaxDbiQ497L8.
PRIDEiQ497L8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000019978; ENSMUSP00000019978; ENSMUSG00000019834. [Q497L8-2]
ENSMUST00000078314; ENSMUSP00000077428; ENSMUSG00000019834. [Q497L8-1]
GeneIDi70840.
KEGGimmu:70840.
UCSCiuc007ewz.1. mouse. [Q497L8-1]

Organism-specific databases

CTDi85413.
MGIiMGI:1918090. Slc22a16.

Phylogenomic databases

eggNOGiKOG0255. Eukaryota.
COG0477. LUCA.
GeneTreeiENSGT00760000118852.
HOGENOMiHOG000060147.
HOVERGENiHBG108436.
InParanoidiQ497L8.
KOiK08212.
OMAiPAYVIAC.
OrthoDBiEOG091G03V1.
PhylomeDBiQ497L8.
TreeFamiTF315847.

Enzyme and pathway databases

ReactomeiR-MMU-549127. Organic cation transport.

Miscellaneous databases

PROiQ497L8.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000019834.
ExpressionAtlasiQ497L8. baseline and differential.
GenevisibleiQ497L8. MM.

Family and domain databases

CDDicd06174. MFS. 1 hit.
InterProiIPR020846. MFS_dom.
IPR005828. MFS_sugar_transport-like.
[Graphical view]
PfamiPF00083. Sugar_tr. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiS22AG_MOUSE
AccessioniPrimary (citable) accession number: Q497L8
Secondary accession number(s): Q3LVC1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: September 13, 2005
Last modified: November 30, 2016
This is version 88 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.