Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Alpha-(1,3)-fucosyltransferase 11

Gene

FUT11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Probable fucosyltransferase.By similarity

Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Enzyme and pathway databases

BRENDAi2.4.1.152. 2681.
2.4.1.65. 2681.
UniPathwayiUPA00378.

Protein family/group databases

CAZyiGT10. Glycosyltransferase Family 10.

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-(1,3)-fucosyltransferase 11 (EC:2.4.1.-)
Alternative name(s):
Fucosyltransferase XI
Short name:
Fuc-TXI
Short name:
FucT-XI
Galactoside 3-L-fucosyltransferase 11
Short name:
Fucosyltransferase 11
Gene namesi
Name:FUT11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:19233. FUT11.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 77CytoplasmicSequence analysis
Transmembranei8 – 2417Helical; Signal-anchor for type II membrane proteinSequence analysisAdd
BLAST
Topological domaini25 – 492468LumenalSequence analysisAdd
BLAST

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • Golgi cisterna membrane Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134914077.

Polymorphism and mutation databases

BioMutaiFUT11.
DMDMi121943313.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 492492Alpha-(1,3)-fucosyltransferase 11PRO_0000299009Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi98 ↔ 103By similarity
Glycosylationi166 – 1661N-linked (GlcNAc...)Sequence analysis
Disulfide bondi389 ↔ 392By similarity
Glycosylationi443 – 4431N-linked (GlcNAc...)1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ495W5.
MaxQBiQ495W5.
PaxDbiQ495W5.
PRIDEiQ495W5.

PTM databases

iPTMnetiQ495W5.
PhosphoSiteiQ495W5.

Expressioni

Gene expression databases

BgeeiQ495W5.
CleanExiHS_FUT11.
GenevisibleiQ495W5. HS.

Organism-specific databases

HPAiHPA014033.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
MEOX2A4D1273EBI-2907712,EBI-10172134
RELQ048643EBI-2907712,EBI-307352

Protein-protein interaction databases

BioGridi128001. 23 interactions.
IntActiQ495W5. 3 interactions.
STRINGi9606.ENSP00000361932.

Structurei

3D structure databases

ProteinModelPortaliQ495W5.
SMRiQ495W5. Positions 270-356.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the glycosyltransferase 10 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2619. Eukaryota.
ENOG410ZIMX. LUCA.
GeneTreeiENSGT00680000099679.
HOGENOMiHOG000006538.
HOVERGENiHBG055521.
InParanoidiQ495W5.
KOiK11257.
OMAiGLFPHFP.
OrthoDBiEOG7H1JJV.
PhylomeDBiQ495W5.
TreeFamiTF316348.

Family and domain databases

InterProiIPR017176. Alpha-1_3-FUT_met.
IPR031481. Glyco_tran_10_N.
IPR001503. Glyco_trans_10.
[Graphical view]
PANTHERiPTHR11929. PTHR11929. 1 hit.
PfamiPF17039. Glyco_tran_10_N. 1 hit.
PF00852. Glyco_transf_10. 1 hit.
[Graphical view]
PIRSFiPIRSF037332. Alpha1_3FUT_met. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q495W5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAGPIRVVL VLLGVLSVCA ASGHGSVAER EAGGEAEWAE PWDGAVFRPP
60 70 80 90 100
SALGAVGVTR SSGTPRPGRE EAGDLPVLLW WSPGLFPHFP GDSERIECAR
110 120 130 140 150
GACVASRNRR ALRDSRTRAL LFYGTDFRAS AAPLPRLAHQ SWALLHEESP
160 170 180 190 200
LNNFLLSHGP GIRLFNLTST FSRHSDYPLS LQWLPGTAYL RRPVPPPMER
210 220 230 240 250
AEWRRRGYAP LLYLQSHCDV PADRDRYVRE LMRHIPVDSY GKCLQNRELP
260 270 280 290 300
TARLQDTATA TTEDPELLAF LSRYKFHLAL ENAICNDYMT EKLWRPMHLG
310 320 330 340 350
AVPVYRGSPS VRDWMPNNHS VILIDDFESP QKLAEFIDFL DKNDEEYMKY
360 370 380 390 400
LAYKQPGGIT NQFLLDSLKH REWGVNDPLL PNYLNGFECF VCDYELARLD
410 420 430 440 450
AEKAHAASPG DSPVFEPHIA QPSHMDCPVP TPGFGNVEEI PENDSWKEMW
460 470 480 490
LQDYWQGLDQ GEALTAMIHN NETEQTKFWD YLHEIFMKRQ HL
Length:492
Mass (Da):55,816
Last modified:September 13, 2005 - v1
Checksum:i19ED65D27DA6B30E
GO
Isoform 2 (identifier: Q495W5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     446-492: WKEMWLQDYW...HEIFMKRQHL → SLVQVRDHCICLRFLWPHSEKGRTHNYAAVP

Note: No experimental confirmation available.
Show »
Length:476
Mass (Da):53,510
Checksum:i01B3EBCA908931DA
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti51 – 511S → A.1 Publication
Corresponds to variant rs17853514 [ dbSNP | Ensembl ].
VAR_034763

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei446 – 49247WKEMW…KRQHL → SLVQVRDHCICLRFLWPHSE KGRTHNYAAVP in isoform 2. 1 PublicationVSP_027511Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC036037 mRNA. Translation: AAH36037.1.
BC100994 mRNA. Translation: AAI00995.1.
BC100995 mRNA. Translation: AAI00996.1.
BC100996 mRNA. Translation: AAI00997.1.
BC100997 mRNA. Translation: AAI00998.1.
CCDSiCCDS60558.1. [Q495W5-2]
CCDS7333.1. [Q495W5-1]
RefSeqiNP_001271123.1. NM_001284194.1. [Q495W5-2]
NP_775811.2. NM_173540.2. [Q495W5-1]
UniGeneiHs.588854.

Genome annotation databases

EnsembliENST00000372841; ENSP00000361932; ENSG00000196968. [Q495W5-1]
ENST00000394790; ENSP00000378270; ENSG00000196968. [Q495W5-2]
GeneIDi170384.
KEGGihsa:170384.
UCSCiuc001juz.3. human. [Q495W5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - GTase

Fucosyltransferase 11

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BC036037 mRNA. Translation: AAH36037.1.
BC100994 mRNA. Translation: AAI00995.1.
BC100995 mRNA. Translation: AAI00996.1.
BC100996 mRNA. Translation: AAI00997.1.
BC100997 mRNA. Translation: AAI00998.1.
CCDSiCCDS60558.1. [Q495W5-2]
CCDS7333.1. [Q495W5-1]
RefSeqiNP_001271123.1. NM_001284194.1. [Q495W5-2]
NP_775811.2. NM_173540.2. [Q495W5-1]
UniGeneiHs.588854.

3D structure databases

ProteinModelPortaliQ495W5.
SMRiQ495W5. Positions 270-356.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128001. 23 interactions.
IntActiQ495W5. 3 interactions.
STRINGi9606.ENSP00000361932.

Protein family/group databases

CAZyiGT10. Glycosyltransferase Family 10.

PTM databases

iPTMnetiQ495W5.
PhosphoSiteiQ495W5.

Polymorphism and mutation databases

BioMutaiFUT11.
DMDMi121943313.

Proteomic databases

EPDiQ495W5.
MaxQBiQ495W5.
PaxDbiQ495W5.
PRIDEiQ495W5.

Protocols and materials databases

DNASUi170384.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372841; ENSP00000361932; ENSG00000196968. [Q495W5-1]
ENST00000394790; ENSP00000378270; ENSG00000196968. [Q495W5-2]
GeneIDi170384.
KEGGihsa:170384.
UCSCiuc001juz.3. human. [Q495W5-1]

Organism-specific databases

CTDi170384.
GeneCardsiFUT11.
H-InvDBHIX0035535.
HGNCiHGNC:19233. FUT11.
HPAiHPA014033.
neXtProtiNX_Q495W5.
PharmGKBiPA134914077.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2619. Eukaryota.
ENOG410ZIMX. LUCA.
GeneTreeiENSGT00680000099679.
HOGENOMiHOG000006538.
HOVERGENiHBG055521.
InParanoidiQ495W5.
KOiK11257.
OMAiGLFPHFP.
OrthoDBiEOG7H1JJV.
PhylomeDBiQ495W5.
TreeFamiTF316348.

Enzyme and pathway databases

UniPathwayiUPA00378.
BRENDAi2.4.1.152. 2681.
2.4.1.65. 2681.

Miscellaneous databases

GenomeRNAii170384.
NextBioi88907.
PROiQ495W5.

Gene expression databases

BgeeiQ495W5.
CleanExiHS_FUT11.
GenevisibleiQ495W5. HS.

Family and domain databases

InterProiIPR017176. Alpha-1_3-FUT_met.
IPR031481. Glyco_tran_10_N.
IPR001503. Glyco_trans_10.
[Graphical view]
PANTHERiPTHR11929. PTHR11929. 1 hit.
PfamiPF17039. Glyco_tran_10_N. 1 hit.
PF00852. Glyco_transf_10. 1 hit.
[Graphical view]
PIRSFiPIRSF037332. Alpha1_3FUT_met. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ALA-51.
    Tissue: Testis.
  2. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-443.
    Tissue: Liver.

Entry informationi

Entry nameiFUT11_HUMAN
AccessioniPrimary (citable) accession number: Q495W5
Secondary accession number(s): Q495W7, Q8IYE4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: September 13, 2005
Last modified: March 16, 2016
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.