Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Proton-coupled amino acid transporter 3

Gene

SLC36A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Protein family/group databases

TCDBi2.A.18.8.4. the amino acid/auxin permease (aaap) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Proton-coupled amino acid transporter 3
Short name:
Proton/amino acid transporter 3
Alternative name(s):
Solute carrier family 36 member 3
Tramdorin-2
Gene namesi
Name:SLC36A3
Synonyms:PAT3, TRAMD2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:19659. SLC36A3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4646CytoplasmicSequence analysisAdd
BLAST
Transmembranei47 – 6721HelicalSequence analysisAdd
BLAST
Topological domaini68 – 714ExtracellularSequence analysis
Transmembranei72 – 9221HelicalSequence analysisAdd
BLAST
Topological domaini93 – 13745CytoplasmicSequence analysisAdd
BLAST
Transmembranei138 – 15821HelicalSequence analysisAdd
BLAST
Topological domaini159 – 18527ExtracellularSequence analysisAdd
BLAST
Transmembranei186 – 20621HelicalSequence analysisAdd
BLAST
Topological domaini207 – 2104CytoplasmicSequence analysis
Transmembranei211 – 23121HelicalSequence analysisAdd
BLAST
Topological domaini232 – 25221ExtracellularSequence analysisAdd
BLAST
Transmembranei253 – 27321HelicalSequence analysisAdd
BLAST
Topological domaini274 – 28411CytoplasmicSequence analysisAdd
BLAST
Transmembranei285 – 30521HelicalSequence analysisAdd
BLAST
Topological domaini306 – 33732ExtracellularSequence analysisAdd
BLAST
Transmembranei338 – 35821HelicalSequence analysisAdd
BLAST
Topological domaini359 – 3679CytoplasmicSequence analysis
Transmembranei368 – 38821HelicalSequence analysisAdd
BLAST
Topological domaini389 – 3924ExtracellularSequence analysis
Transmembranei393 – 41321HelicalSequence analysisAdd
BLAST
Topological domaini414 – 42512CytoplasmicSequence analysisAdd
BLAST
Transmembranei426 – 44621HelicalSequence analysisAdd
BLAST
Topological domaini447 – 47024ExtracellularSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134875494.

Polymorphism and mutation databases

BioMutaiSLC36A3.
DMDMi172046109.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 470470Proton-coupled amino acid transporter 3PRO_0000326204Add
BLAST

Post-translational modificationi

Isoform 3 is phosphorylated on Tyr-175.

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRIDEiQ495N2.

Expressioni

Tissue specificityi

Specifically expressed in testis.1 Publication

Gene expression databases

BgeeiQ495N2.
CleanExiHS_SLC36A3.

Organism-specific databases

HPAiHPA051232.

Interactioni

Protein-protein interaction databases

BioGridi130167. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ495N2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi21 – 288Poly-Ser

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000011245.
HOGENOMiHOG000006823.
HOVERGENiHBG057183.
InParanoidiQ495N2.
KOiK14209.
OMAiAMMYSLE.
OrthoDBiEOG73V6KC.
PhylomeDBiQ495N2.
TreeFamiTF314873.

Family and domain databases

InterProiIPR013057. AA_transpt_TM.
[Graphical view]
PfamiPF01490. Aa_trans. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q495N2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLLGRDYNS ELNSLDNGPQ SPSESSSSIT SENVHPAGEA GLSMMQTLIH
60 70 80 90 100
LLKCNIGTGL LGLPLAIKNA GLLVGPVSLL AIGVLTVHCM VILLNCAQHL
110 120 130 140 150
SQRLQKTFVN YGEATMYGLE TCPNTWLRAH AVWGRYTVSF LLVITQLGFC
160 170 180 190 200
SVYFMFMADN LQQMVEKAHV TSNICQPREI LTLTPILDIR FYMLIILPFL
210 220 230 240 250
ILLVFIQNLK VLSVFSTLAN ITTLGSMALI FEYIMEGIPY PSNLPLMANW
260 270 280 290 300
KTFLLFFGTA IFTFEGVGMV LPLKNQMKHP QQFSFVLYLG MSIVIILYIL
310 320 330 340 350
LGTLGYMKFG SDTQASITLN LPNCWLYQSV KLMYSIGIFF TYALQFHVPA
360 370 380 390 400
EIIIPFAISQ VSESWALFVD LSVRSALVCL TCVSAILIPR LDLVISLVGS
410 420 430 440 450
VSSSALALII PALLEIVIFY SEDMSCVTIA KDIMISIVGL LGCIFGTYQA
460 470
LYELPQPISH SMANSTGVHA
Length:470
Mass (Da):51,735
Last modified:March 18, 2008 - v2
Checksum:iAA192584E6BFE848
GO
Isoform 2 (identifier: Q495N2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MSLLGRDYNS...PLAIKNAGLL → MGVIISGSLPPFSSPLQ
     135-135: R → RWNLALSPRLECSGKISAHCNPHLQGSSNSPAQASRVAGIYR

Note: No experimental confirmation available.
Show »
Length:455
Mass (Da):50,247
Checksum:iD54930AF944FA361
GO
Isoform 3 (identifier: Q495N2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-135: R → RWNLALSPRLECSGKISAHCNPHLQGSSNSPAQASRVAGIYR

Show »
Length:511
Mass (Da):56,095
Checksum:iDF198474F30498A5
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti314 – 3141Q → R in AAI01095 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti167 – 1671K → E.2 Publications
Corresponds to variant rs978012 [ dbSNP | Ensembl ].
VAR_040006
Natural varianti185 – 1851P → S.
Corresponds to variant rs12520516 [ dbSNP | Ensembl ].
VAR_040007
Natural varianti190 – 1901R → H.
Corresponds to variant rs17660042 [ dbSNP | Ensembl ].
VAR_040008
Natural varianti415 – 4151E → D.
Corresponds to variant rs13155282 [ dbSNP | Ensembl ].
VAR_040009
Natural varianti421 – 4211S → F.
Corresponds to variant rs13155520 [ dbSNP | Ensembl ].
VAR_040010

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7373MSLLG…NAGLL → MGVIISGSLPPFSSPLQ in isoform 2. 1 PublicationVSP_032601Add
BLAST
Alternative sequencei135 – 1351R → RWNLALSPRLECSGKISAHC NPHLQGSSNSPAQASRVAGI YR in isoform 2 and isoform 3. 2 PublicationsVSP_032602

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY162215 mRNA. Translation: AAO11789.1.
AK127978 mRNA. Translation: BAC87215.1.
AK131483 mRNA. Translation: BAD18628.1.
CH471062 Genomic DNA. Translation: EAW61679.1.
BC101092 mRNA. Translation: AAI01093.1.
BC101093 mRNA. Translation: AAI01094.1.
BC101094 mRNA. Translation: AAI01095.1.
BC101095 mRNA. Translation: AAI01096.1.
CCDSiCCDS4314.1. [Q495N2-1]
CCDS47316.1. [Q495N2-3]
RefSeqiNP_001138489.1. NM_001145017.1. [Q495N2-3]
NP_861439.3. NM_181774.3. [Q495N2-1]
UniGeneiHs.720893.

Genome annotation databases

EnsembliENST00000335230; ENSP00000334750; ENSG00000186334. [Q495N2-1]
ENST00000377713; ENSP00000366942; ENSG00000186334. [Q495N2-3]
GeneIDi285641.
KEGGihsa:285641.
UCSCiuc003ltw.3. human. [Q495N2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY162215 mRNA. Translation: AAO11789.1.
AK127978 mRNA. Translation: BAC87215.1.
AK131483 mRNA. Translation: BAD18628.1.
CH471062 Genomic DNA. Translation: EAW61679.1.
BC101092 mRNA. Translation: AAI01093.1.
BC101093 mRNA. Translation: AAI01094.1.
BC101094 mRNA. Translation: AAI01095.1.
BC101095 mRNA. Translation: AAI01096.1.
CCDSiCCDS4314.1. [Q495N2-1]
CCDS47316.1. [Q495N2-3]
RefSeqiNP_001138489.1. NM_001145017.1. [Q495N2-3]
NP_861439.3. NM_181774.3. [Q495N2-1]
UniGeneiHs.720893.

3D structure databases

ProteinModelPortaliQ495N2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130167. 1 interaction.

Protein family/group databases

TCDBi2.A.18.8.4. the amino acid/auxin permease (aaap) family.

Polymorphism and mutation databases

BioMutaiSLC36A3.
DMDMi172046109.

Proteomic databases

PRIDEiQ495N2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335230; ENSP00000334750; ENSG00000186334. [Q495N2-1]
ENST00000377713; ENSP00000366942; ENSG00000186334. [Q495N2-3]
GeneIDi285641.
KEGGihsa:285641.
UCSCiuc003ltw.3. human. [Q495N2-1]

Organism-specific databases

CTDi285641.
GeneCardsiSLC36A3.
HGNCiHGNC:19659. SLC36A3.
HPAiHPA051232.
MIMi608332. gene.
neXtProtiNX_Q495N2.
PharmGKBiPA134875494.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000011245.
HOGENOMiHOG000006823.
HOVERGENiHBG057183.
InParanoidiQ495N2.
KOiK14209.
OMAiAMMYSLE.
OrthoDBiEOG73V6KC.
PhylomeDBiQ495N2.
TreeFamiTF314873.

Miscellaneous databases

GenomeRNAii285641.
NextBioi95675.
PROiQ495N2.
SOURCEiSearch...

Gene expression databases

BgeeiQ495N2.
CleanExiHS_SLC36A3.

Family and domain databases

InterProiIPR013057. AA_transpt_TM.
[Graphical view]
PfamiPF01490. Aa_trans. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A cluster of proton/amino acid transporter genes in the human and mouse genomes."
    Boll M., Foltz M., Rubio-Aliaga I., Daniel H.
    Genomics 82:47-56(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT GLU-167.
    Tissue: Testis.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-167.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
  5. "Organization and expression of the SLC36 cluster of amino acid transporter genes."
    Bermingham J.R. Jr., Pennington J.
    Mamm. Genome 15:114-125(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiS36A3_HUMAN
AccessioniPrimary (citable) accession number: Q495N2
Secondary accession number(s): Q495N3
, Q6ZMU7, Q6ZRU4, Q7Z6B4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: March 16, 2016
This is version 78 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.