Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Proton-coupled amino acid transporter 3

Gene

SLC36A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:G66-31592-MONOMER.

Protein family/group databases

TCDBi2.A.18.8.4. the amino acid/auxin permease (aaap) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Proton-coupled amino acid transporter 3
Short name:
Proton/amino acid transporter 3
Alternative name(s):
Solute carrier family 36 member 3
Tramdorin-2
Gene namesi
Name:SLC36A3
Synonyms:PAT3, TRAMD2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:19659. SLC36A3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 46CytoplasmicSequence analysisAdd BLAST46
Transmembranei47 – 67HelicalSequence analysisAdd BLAST21
Topological domaini68 – 71ExtracellularSequence analysis4
Transmembranei72 – 92HelicalSequence analysisAdd BLAST21
Topological domaini93 – 137CytoplasmicSequence analysisAdd BLAST45
Transmembranei138 – 158HelicalSequence analysisAdd BLAST21
Topological domaini159 – 185ExtracellularSequence analysisAdd BLAST27
Transmembranei186 – 206HelicalSequence analysisAdd BLAST21
Topological domaini207 – 210CytoplasmicSequence analysis4
Transmembranei211 – 231HelicalSequence analysisAdd BLAST21
Topological domaini232 – 252ExtracellularSequence analysisAdd BLAST21
Transmembranei253 – 273HelicalSequence analysisAdd BLAST21
Topological domaini274 – 284CytoplasmicSequence analysisAdd BLAST11
Transmembranei285 – 305HelicalSequence analysisAdd BLAST21
Topological domaini306 – 337ExtracellularSequence analysisAdd BLAST32
Transmembranei338 – 358HelicalSequence analysisAdd BLAST21
Topological domaini359 – 367CytoplasmicSequence analysis9
Transmembranei368 – 388HelicalSequence analysisAdd BLAST21
Topological domaini389 – 392ExtracellularSequence analysis4
Transmembranei393 – 413HelicalSequence analysisAdd BLAST21
Topological domaini414 – 425CytoplasmicSequence analysisAdd BLAST12
Transmembranei426 – 446HelicalSequence analysisAdd BLAST21
Topological domaini447 – 470ExtracellularSequence analysisAdd BLAST24

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000186334.
PharmGKBiPA134875494.

Polymorphism and mutation databases

BioMutaiSLC36A3.
DMDMi172046109.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003262041 – 470Proton-coupled amino acid transporter 3Add BLAST470

Post-translational modificationi

Isoform 3 is phosphorylated on Tyr-175.

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRIDEiQ495N2.

PTM databases

PhosphoSitePlusiQ495N2.

Expressioni

Tissue specificityi

Specifically expressed in testis.1 Publication

Gene expression databases

BgeeiENSG00000186334.
CleanExiHS_SLC36A3.

Interactioni

Protein-protein interaction databases

BioGridi130167. 1 interactor.

Structurei

3D structure databases

ProteinModelPortaliQ495N2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi21 – 28Poly-Ser8

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000011245.
HOGENOMiHOG000006823.
HOVERGENiHBG057183.
InParanoidiQ495N2.
KOiK14209.
OMAiAMMYSLE.
OrthoDBiEOG091G079T.
PhylomeDBiQ495N2.
TreeFamiTF314873.

Family and domain databases

InterProiIPR013057. AA_transpt_TM.
[Graphical view]
PfamiPF01490. Aa_trans. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q495N2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLLGRDYNS ELNSLDNGPQ SPSESSSSIT SENVHPAGEA GLSMMQTLIH
60 70 80 90 100
LLKCNIGTGL LGLPLAIKNA GLLVGPVSLL AIGVLTVHCM VILLNCAQHL
110 120 130 140 150
SQRLQKTFVN YGEATMYGLE TCPNTWLRAH AVWGRYTVSF LLVITQLGFC
160 170 180 190 200
SVYFMFMADN LQQMVEKAHV TSNICQPREI LTLTPILDIR FYMLIILPFL
210 220 230 240 250
ILLVFIQNLK VLSVFSTLAN ITTLGSMALI FEYIMEGIPY PSNLPLMANW
260 270 280 290 300
KTFLLFFGTA IFTFEGVGMV LPLKNQMKHP QQFSFVLYLG MSIVIILYIL
310 320 330 340 350
LGTLGYMKFG SDTQASITLN LPNCWLYQSV KLMYSIGIFF TYALQFHVPA
360 370 380 390 400
EIIIPFAISQ VSESWALFVD LSVRSALVCL TCVSAILIPR LDLVISLVGS
410 420 430 440 450
VSSSALALII PALLEIVIFY SEDMSCVTIA KDIMISIVGL LGCIFGTYQA
460 470
LYELPQPISH SMANSTGVHA
Length:470
Mass (Da):51,735
Last modified:March 18, 2008 - v2
Checksum:iAA192584E6BFE848
GO
Isoform 2 (identifier: Q495N2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MSLLGRDYNS...PLAIKNAGLL → MGVIISGSLPPFSSPLQ
     135-135: R → RWNLALSPRLECSGKISAHCNPHLQGSSNSPAQASRVAGIYR

Note: No experimental confirmation available.
Show »
Length:455
Mass (Da):50,247
Checksum:iD54930AF944FA361
GO
Isoform 3 (identifier: Q495N2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-135: R → RWNLALSPRLECSGKISAHCNPHLQGSSNSPAQASRVAGIYR

Show »
Length:511
Mass (Da):56,095
Checksum:iDF198474F30498A5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti314Q → R in AAI01095 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_040006167K → E.2 PublicationsCorresponds to variant rs978012dbSNPEnsembl.1
Natural variantiVAR_040007185P → S.Corresponds to variant rs12520516dbSNPEnsembl.1
Natural variantiVAR_040008190R → H.Corresponds to variant rs17660042dbSNPEnsembl.1
Natural variantiVAR_040009415E → D.Corresponds to variant rs13155282dbSNPEnsembl.1
Natural variantiVAR_040010421S → F.Corresponds to variant rs13155520dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0326011 – 73MSLLG…NAGLL → MGVIISGSLPPFSSPLQ in isoform 2. 1 PublicationAdd BLAST73
Alternative sequenceiVSP_032602135R → RWNLALSPRLECSGKISAHC NPHLQGSSNSPAQASRVAGI YR in isoform 2 and isoform 3. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY162215 mRNA. Translation: AAO11789.1.
AK127978 mRNA. Translation: BAC87215.1.
AK131483 mRNA. Translation: BAD18628.1.
CH471062 Genomic DNA. Translation: EAW61679.1.
BC101092 mRNA. Translation: AAI01093.1.
BC101093 mRNA. Translation: AAI01094.1.
BC101094 mRNA. Translation: AAI01095.1.
BC101095 mRNA. Translation: AAI01096.1.
CCDSiCCDS4314.1. [Q495N2-1]
CCDS47316.1. [Q495N2-3]
RefSeqiNP_001138489.1. NM_001145017.1. [Q495N2-3]
NP_861439.3. NM_181774.3. [Q495N2-1]
UniGeneiHs.720893.

Genome annotation databases

EnsembliENST00000335230; ENSP00000334750; ENSG00000186334. [Q495N2-1]
ENST00000377713; ENSP00000366942; ENSG00000186334. [Q495N2-3]
GeneIDi285641.
KEGGihsa:285641.
UCSCiuc003ltw.3. human. [Q495N2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY162215 mRNA. Translation: AAO11789.1.
AK127978 mRNA. Translation: BAC87215.1.
AK131483 mRNA. Translation: BAD18628.1.
CH471062 Genomic DNA. Translation: EAW61679.1.
BC101092 mRNA. Translation: AAI01093.1.
BC101093 mRNA. Translation: AAI01094.1.
BC101094 mRNA. Translation: AAI01095.1.
BC101095 mRNA. Translation: AAI01096.1.
CCDSiCCDS4314.1. [Q495N2-1]
CCDS47316.1. [Q495N2-3]
RefSeqiNP_001138489.1. NM_001145017.1. [Q495N2-3]
NP_861439.3. NM_181774.3. [Q495N2-1]
UniGeneiHs.720893.

3D structure databases

ProteinModelPortaliQ495N2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130167. 1 interactor.

Protein family/group databases

TCDBi2.A.18.8.4. the amino acid/auxin permease (aaap) family.

PTM databases

PhosphoSitePlusiQ495N2.

Polymorphism and mutation databases

BioMutaiSLC36A3.
DMDMi172046109.

Proteomic databases

PRIDEiQ495N2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335230; ENSP00000334750; ENSG00000186334. [Q495N2-1]
ENST00000377713; ENSP00000366942; ENSG00000186334. [Q495N2-3]
GeneIDi285641.
KEGGihsa:285641.
UCSCiuc003ltw.3. human. [Q495N2-1]

Organism-specific databases

CTDi285641.
GeneCardsiSLC36A3.
HGNCiHGNC:19659. SLC36A3.
MIMi608332. gene.
neXtProtiNX_Q495N2.
OpenTargetsiENSG00000186334.
PharmGKBiPA134875494.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000011245.
HOGENOMiHOG000006823.
HOVERGENiHBG057183.
InParanoidiQ495N2.
KOiK14209.
OMAiAMMYSLE.
OrthoDBiEOG091G079T.
PhylomeDBiQ495N2.
TreeFamiTF314873.

Enzyme and pathway databases

BioCyciZFISH:G66-31592-MONOMER.

Miscellaneous databases

GenomeRNAii285641.
PROiQ495N2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000186334.
CleanExiHS_SLC36A3.

Family and domain databases

InterProiIPR013057. AA_transpt_TM.
[Graphical view]
PfamiPF01490. Aa_trans. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiS36A3_HUMAN
AccessioniPrimary (citable) accession number: Q495N2
Secondary accession number(s): Q495N3
, Q6ZMU7, Q6ZRU4, Q7Z6B4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: November 2, 2016
This is version 83 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.