Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Poly [ADP-ribose] polymerase 14

Gene

PARP14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Enhances STAT6-dependent transcription (By similarity). Has ADP-ribosyltransferase activity.By similarity1 Publication

Catalytic activityi

NAD+ + (ADP-D-ribosyl)(n)-acceptor = nicotinamide + (ADP-D-ribosyl)(n+1)-acceptor.PROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

NAD

Enzyme and pathway databases

BRENDAi2.4.2.30. 2681.

Names & Taxonomyi

Protein namesi
Recommended name:
Poly [ADP-ribose] polymerase 14 (EC:2.4.2.30)
Short name:
PARP-14
Alternative name(s):
ADP-ribosyltransferase diphtheria toxin-like 8
Short name:
ARTD8
B aggressive lymphoma protein 2
Gene namesi
Name:PARP14
Synonyms:BAL2, KIAA1268
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:29232. PARP14.

Subcellular locationi

  • Nucleus
  • Cytoplasm

  • Note: In steady state cells the protein is mostly nuclear. A minor proportion is detected in the cytoplasm (By similarity).By similarity

GO - Cellular componenti

  • cytoplasm Source: HPA
  • membrane Source: UniProtKB
  • nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134861585.

Chemistry

ChEMBLiCHEMBL2176777.

Polymorphism and mutation databases

BioMutaiPARP14.
DMDMi327478567.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 18011801Poly [ADP-ribose] polymerase 14PRO_0000247589Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1403 – 14031PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ460N5.
MaxQBiQ460N5.
PaxDbiQ460N5.
PRIDEiQ460N5.

PTM databases

iPTMnetiQ460N5.
PhosphoSiteiQ460N5.

Expressioni

Gene expression databases

BgeeiQ460N5.
CleanExiHS_PARP14.
ExpressionAtlasiQ460N5. baseline and differential.
GenevisibleiQ460N5. HS.

Organism-specific databases

HPAiHPA008846.
HPA012063.

Interactioni

Subunit structurei

Interacts with STAT6.By similarity

Protein-protein interaction databases

BioGridi120082. 12 interactions.
DIPiDIP-61130N.
STRINGi9606.ENSP00000418194.

Chemistry

BindingDBiQ460N5.

Structurei

Secondary structure

1
1801
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi792 – 7998Combined sources
Beta strandi802 – 8087Combined sources
Beta strandi815 – 8239Combined sources
Helixi832 – 84110Combined sources
Helixi844 – 85613Combined sources
Beta strandi861 – 8688Combined sources
Beta strandi872 – 88110Combined sources
Helixi887 – 8893Combined sources
Helixi890 – 91021Combined sources
Beta strandi914 – 9185Combined sources
Turni921 – 9266Combined sources
Helixi930 – 94718Combined sources
Beta strandi956 – 9638Combined sources
Helixi964 – 97714Combined sources
Beta strandi1007 – 10093Combined sources
Beta strandi1015 – 10195Combined sources
Helixi1023 – 10253Combined sources
Beta strandi1028 – 10347Combined sources
Beta strandi1041 – 10444Combined sources
Helixi1045 – 105410Combined sources
Helixi1057 – 106610Combined sources
Beta strandi1076 – 10805Combined sources
Beta strandi1084 – 10929Combined sources
Helixi1098 – 11003Combined sources
Helixi1102 – 112120Combined sources
Beta strandi1126 – 11305Combined sources
Helixi1141 – 115818Combined sources
Beta strandi1166 – 11705Combined sources
Helixi1176 – 118914Combined sources
Beta strandi1213 – 12164Combined sources
Beta strandi1220 – 12245Combined sources
Beta strandi1227 – 12348Combined sources
Helixi1236 – 12383Combined sources
Beta strandi1242 – 12487Combined sources
Helixi1258 – 12669Combined sources
Helixi1268 – 128013Combined sources
Beta strandi1284 – 12896Combined sources
Beta strandi1293 – 130210Combined sources
Helixi1307 – 132014Combined sources
Beta strandi1325 – 13284Combined sources
Helixi1340 – 135617Combined sources
Beta strandi1365 – 13717Combined sources
Helixi1373 – 138614Combined sources
Beta strandi1617 – 16215Combined sources
Helixi1629 – 164012Combined sources
Beta strandi1643 – 165210Combined sources
Helixi1654 – 167017Combined sources
Turni1671 – 16733Combined sources
Beta strandi1677 – 16848Combined sources
Helixi1686 – 16883Combined sources
Helixi1689 – 16957Combined sources
Turni1699 – 17013Combined sources
Helixi1704 – 17063Combined sources
Beta strandi1707 – 17093Combined sources
Beta strandi1713 – 17186Combined sources
Helixi1719 – 17224Combined sources
Turni1725 – 17273Combined sources
Beta strandi1736 – 17449Combined sources
Beta strandi1747 – 17504Combined sources
Beta strandi1765 – 17673Combined sources
Beta strandi1771 – 17755Combined sources
Beta strandi1777 – 17793Combined sources
Beta strandi1781 – 17855Combined sources
Beta strandi1791 – 180010Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3GOYX-ray2.80A/B/C/D1611-1801[»]
3Q6ZX-ray2.23A789-979[»]
3Q71X-ray2.20A999-1196[»]
3SE2X-ray2.30A/B/C/D1611-1801[»]
3SMIX-ray2.40A/B1611-1801[»]
3SMJX-ray1.50A/B1611-1801[»]
3VFQX-ray2.80A784-1196[»]
4ABKX-ray1.60A1208-1388[»]
4ABLX-ray1.15A1208-1388[»]
4D86X-ray2.00A784-1196[»]
4F1LX-ray1.90A/B/C/D1611-1801[»]
4F1QX-ray2.80A/B1611-1801[»]
4PY4X-ray2.76A/B1613-1801[»]
ProteinModelPortaliQ460N5.
SMRiQ460N5. Positions 791-1191, 1208-1388, 1614-1801.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ460N5.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini791 – 978188Macro 1PROSITE-ProRule annotationAdd
BLAST
Domaini1003 – 1190188Macro 2PROSITE-ProRule annotationAdd
BLAST
Domaini1216 – 1387172Macro 3PROSITE-ProRule annotationAdd
BLAST
Domaini1523 – 160179WWEPROSITE-ProRule annotationAdd
BLAST
Domaini1605 – 1801197PARP catalyticPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 Macro domains.PROSITE-ProRule annotation
Contains 1 PARP catalytic domain.PROSITE-ProRule annotation
Contains 1 WWE domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG2633. Eukaryota.
COG2110. LUCA.
GeneTreeiENSGT00760000119084.
HOVERGENiHBG082105.
InParanoidiQ460N5.
KOiK15261.
OMAiRRCHCEL.
OrthoDBiEOG786H2D.
PhylomeDBiQ460N5.
TreeFamiTF328965.

Family and domain databases

Gene3Di3.90.228.10. 1 hit.
InterProiIPR002589. Macro_dom.
IPR012317. Poly(ADP-ribose)pol_cat_dom.
IPR004170. WWE-dom.
[Graphical view]
PfamiPF01661. Macro. 3 hits.
PF00644. PARP. 1 hit.
[Graphical view]
SMARTiSM00506. A1pp. 3 hits.
[Graphical view]
PROSITEiPS51154. MACRO. 3 hits.
PS51059. PARP_CATALYTIC. 1 hit.
PS50918. WWE. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 6 (identifier: Q460N5-6) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVPGSFPLL VEGSWGPDPP KNLNTKLQMY FQSPKRSGGG ECEVRQDPRS
60 70 80 90 100
PSRFLVFFYP EDVRQKVLER KNHELVWQGK GTFKLTVQLP ATPDEIDHVF
110 120 130 140 150
EEELLTKESK TKEDVKEPDV SEELDTKLPL DGGLDKMEDI PEECENISSL
160 170 180 190 200
VAFENLKANV TDIMLILLVE NISGLSNDDF QVEIIRDFDV AVVTFQKHID
210 220 230 240 250
TIRFVDDCTK HHSIKQLQLS PRLLEVTNTI RVENLPPGAD DYSLKLFFEN
260 270 280 290 300
PYNGGGRVAN VEYFPEESSA LIEFFDRKVL DTIMATKLDF NKMPLSVFPY
310 320 330 340 350
YASLGTALYG KEKPLIKLPA PFEESLDLPL WKFLQKKNHL IEEINDEMRR
360 370 380 390 400
CHCELTWSQL SGKVTIRPAA TLVNEGRPRI KTWQADTSTT LSSIRSKYKV
410 420 430 440 450
NPIKVDPTMW DTIKNDVKDD RILIEFDTLK EMVILAGKSE DVQSIEVQVR
460 470 480 490 500
ELIESTTQKI KREEQSLKEK MIISPGRYFL LCHSSLLDHL LTECPEIEIC
510 520 530 540 550
YDRVTQHLCL KGPSADVYKA KCEIQEKVYT MAQKNIQVSP EIFQFLQQVN
560 570 580 590 600
WKEFSKCLFI AQKILALYEL EGTTVLLTSC SSEALLEAEK QMLSALNYKR
610 620 630 640 650
IEVENKEVLH GKKWKGLTHN LLKKQNSSPN TVIINELTSE TTAEVIITGC
660 670 680 690 700
VKEVNETYKL LFNFVEQNMK IERLVEVKPS LVIDYLKTEK KLFWPKIKKV
710 720 730 740 750
NVQVSFNPEN KQKGILLTGS KTEVLKAVDI VKQVWDSVCV KSVHTDKPGA
760 770 780 790 800
KQFFQDKARF YQSEIKRLFG CYIELQENEV MKEGGSPAGQ KCFSRTVLAP
810 820 830 840 850
GVVLIVQQGD LARLPVDVVV NASNEDLKHY GGLAAALSKA AGPELQADCD
860 870 880 890 900
QIVKREGRLL PGNATISKAG KLPYHHVIHA VGPRWSGYEA PRCVYLLRRA
910 920 930 940 950
VQLSLCLAEK YKYRSIAIPA ISSGVFGFPL GRCVETIVSA IKENFQFKKD
960 970 980 990 1000
GHCLKEIYLV DVSEKTVEAF AEAVKTVFKA TLPDTAAPPG LPPAAAGPGK
1010 1020 1030 1040 1050
TSWEKGSLVS PGGLQMLLVK EGVQNAKTDV VVNSVPLDLV LSRGPLSKSL
1060 1070 1080 1090 1100
LEKAGPELQE ELDTVGQGVA VSMGTVLKTS SWNLDCRYVL HVVAPEWRNG
1110 1120 1130 1140 1150
STSSLKIMED IIRECMEITE SLSLKSIAFP AIGTGNLGFP KNIFAELIIS
1160 1170 1180 1190 1200
EVFKFSSKNQ LKTLQEVHFL LHPSDHENIQ AFSDEFARRA NGNLVSDKIP
1210 1220 1230 1240 1250
KAKDTQGFYG TVSSPDSGVY EMKIGSIIFQ VASGDITKEE ADVIVNSTSN
1260 1270 1280 1290 1300
SFNLKAGVSK AILECAGQNV ERECSQQAQQ RKNDYIITGG GFLRCKNIIH
1310 1320 1330 1340 1350
VIGGNDVKSS VSSVLQECEK KNYSSICLPA IGTGNAKQHP DKVAEAIIDA
1360 1370 1380 1390 1400
IEDFVQKGSA QSVKKVKVVI FLPQVLDVFY ANMKKREGTQ LSSQQSVMSK
1410 1420 1430 1440 1450
LASFLGFSKQ SPQKKNHLVL EKKTESATFR VCGENVTCVE YAISWLQDLI
1460 1470 1480 1490 1500
EKEQCPYTSE DECIKDFDEK EYQELNELQK KLNINISLDH KRPLIKVLGI
1510 1520 1530 1540 1550
SRDVMQARDE IEAMIKRVRL AKEQESRADC ISEFIEWQYN DNNTSHCFNK
1560 1570 1580 1590 1600
MTNLKLEDAR REKKKTVDVK INHRHYTVNL NTYTATDTKG HSLSVQRLTK
1610 1620 1630 1640 1650
SKVDIPAHWS DMKQQNFCVV ELLPSDPEYN TVASKFNQTC SHFRIEKIER
1660 1670 1680 1690 1700
IQNPDLWNSY QAKKKTMDAK NGQTMNEKQL FHGTDAGSVP HVNRNGFNRS
1710 1720 1730 1740 1750
YAGKNAVAYG KGTYFAVNAN YSANDTYSRP DANGRKHVYY VRVLTGIYTH
1760 1770 1780 1790 1800
GNHSLIVPPS KNPQNPTDLY DTVTDNVHHP SLFVAFYDYQ AYPEYLITFR

K
Length:1,801
Mass (Da):202,800
Last modified:April 5, 2011 - v3
Checksum:i27B027DFC7E773BD
GO
Isoform 1 (identifier: Q460N5-1) [UniParc]FASTAAdd to basket

Also known as: BAL2B

The sequence of this isoform differs from the canonical sequence as follows:
     119-199: Missing.

Show »
Length:1,720
Mass (Da):193,753
Checksum:iF7EAD232767F2867
GO
Isoform 3 (identifier: Q460N5-3) [UniParc]FASTAAdd to basket

Also known as: BAL2A

The sequence of this isoform differs from the canonical sequence as follows:
     1-283: Missing.

Show »
Length:1,518
Mass (Da):170,601
Checksum:i8B8D7BFCB9682902
GO
Isoform 4 (identifier: Q460N5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1648-1680: IERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQL → VSLLLECSFWMVEISSVMVLYKIHFHSLPITFF
     1681-1801: Missing.

Show »
Length:1,680
Mass (Da):189,177
Checksum:iBCDDC89D51466E28
GO
Isoform 5 (identifier: Q460N5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1004: Missing.
     1005-1013: KGSLVSPGG → MYLRRLLRP

Show »
Length:797
Mass (Da):89,790
Checksum:i978947F6DF05569E
GO

Sequence cautioni

The sequence AAY64449.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAY64450.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB14089.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence DB237115 differs from that shown. Reason: Frameshift at position 48. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti59 – 591Y → C in DB237115 (PubMed:16344560).Curated
Sequence conflicti597 – 5971N → D in BAG65132 (PubMed:14702039).Curated
Sequence conflicti1239 – 12391E → G in BAA91897 (PubMed:14702039).Curated
Sequence conflicti1499 – 14991G → A in AAN08627 (Ref. 1) Curated
Sequence conflicti1521 – 15211A → G in AAN08627 (Ref. 1) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 10041004Missing in isoform 5. 1 PublicationVSP_020013Add
BLAST
Alternative sequencei1 – 283283Missing in isoform 3. 1 PublicationVSP_020014Add
BLAST
Alternative sequencei119 – 19981Missing in isoform 1. 3 PublicationsVSP_040876Add
BLAST
Alternative sequencei1005 – 10139KGSLVSPGG → MYLRRLLRP in isoform 5. 1 PublicationVSP_020017
Alternative sequencei1648 – 168033IERIQ…NEKQL → VSLLLECSFWMVEISSVMVL YKIHFHSLPITFF in isoform 4. 2 PublicationsVSP_020018Add
BLAST
Alternative sequencei1681 – 1801121Missing in isoform 4. 2 PublicationsVSP_020019Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY134858 mRNA. Translation: AAN08627.1.
AC048348 Genomic DNA. No translation available.
AC092908 Genomic DNA. No translation available.
AK001770 mRNA. Translation: BAA91897.1.
AK022542 mRNA. Translation: BAB14089.1. Different initiation.
AK304269 mRNA. Translation: BAG65132.1.
DB237115 mRNA. No translation available.
DQ063584 mRNA. Translation: AAY64449.1. Different initiation.
DQ063585 mRNA. Translation: AAY64450.1. Different initiation.
AB033094 mRNA. Translation: BAA86582.1.
CCDSiCCDS46894.1. [Q460N5-6]
RefSeqiNP_060024.2. NM_017554.2. [Q460N5-6]
UniGeneiHs.518203.

Genome annotation databases

EnsembliENST00000474629; ENSP00000418194; ENSG00000173193. [Q460N5-6]
GeneIDi54625.
KEGGihsa:54625.
UCSCiuc003efq.5. human. [Q460N5-6]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY134858 mRNA. Translation: AAN08627.1.
AC048348 Genomic DNA. No translation available.
AC092908 Genomic DNA. No translation available.
AK001770 mRNA. Translation: BAA91897.1.
AK022542 mRNA. Translation: BAB14089.1. Different initiation.
AK304269 mRNA. Translation: BAG65132.1.
DB237115 mRNA. No translation available.
DQ063584 mRNA. Translation: AAY64449.1. Different initiation.
DQ063585 mRNA. Translation: AAY64450.1. Different initiation.
AB033094 mRNA. Translation: BAA86582.1.
CCDSiCCDS46894.1. [Q460N5-6]
RefSeqiNP_060024.2. NM_017554.2. [Q460N5-6]
UniGeneiHs.518203.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3GOYX-ray2.80A/B/C/D1611-1801[»]
3Q6ZX-ray2.23A789-979[»]
3Q71X-ray2.20A999-1196[»]
3SE2X-ray2.30A/B/C/D1611-1801[»]
3SMIX-ray2.40A/B1611-1801[»]
3SMJX-ray1.50A/B1611-1801[»]
3VFQX-ray2.80A784-1196[»]
4ABKX-ray1.60A1208-1388[»]
4ABLX-ray1.15A1208-1388[»]
4D86X-ray2.00A784-1196[»]
4F1LX-ray1.90A/B/C/D1611-1801[»]
4F1QX-ray2.80A/B1611-1801[»]
4PY4X-ray2.76A/B1613-1801[»]
ProteinModelPortaliQ460N5.
SMRiQ460N5. Positions 791-1191, 1208-1388, 1614-1801.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120082. 12 interactions.
DIPiDIP-61130N.
STRINGi9606.ENSP00000418194.

Chemistry

BindingDBiQ460N5.
ChEMBLiCHEMBL2176777.

PTM databases

iPTMnetiQ460N5.
PhosphoSiteiQ460N5.

Polymorphism and mutation databases

BioMutaiPARP14.
DMDMi327478567.

Proteomic databases

EPDiQ460N5.
MaxQBiQ460N5.
PaxDbiQ460N5.
PRIDEiQ460N5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000474629; ENSP00000418194; ENSG00000173193. [Q460N5-6]
GeneIDi54625.
KEGGihsa:54625.
UCSCiuc003efq.5. human. [Q460N5-6]

Organism-specific databases

CTDi54625.
GeneCardsiPARP14.
H-InvDBHIX0019605.
HGNCiHGNC:29232. PARP14.
HPAiHPA008846.
HPA012063.
MIMi610028. gene.
neXtProtiNX_Q460N5.
PharmGKBiPA134861585.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2633. Eukaryota.
COG2110. LUCA.
GeneTreeiENSGT00760000119084.
HOVERGENiHBG082105.
InParanoidiQ460N5.
KOiK15261.
OMAiRRCHCEL.
OrthoDBiEOG786H2D.
PhylomeDBiQ460N5.
TreeFamiTF328965.

Enzyme and pathway databases

BRENDAi2.4.2.30. 2681.

Miscellaneous databases

ChiTaRSiPARP14. human.
EvolutionaryTraceiQ460N5.
GenomeRNAii54625.
NextBioi57162.
PROiQ460N5.
SOURCEiSearch...

Gene expression databases

BgeeiQ460N5.
CleanExiHS_PARP14.
ExpressionAtlasiQ460N5. baseline and differential.
GenevisibleiQ460N5. HS.

Family and domain databases

Gene3Di3.90.228.10. 1 hit.
InterProiIPR002589. Macro_dom.
IPR012317. Poly(ADP-ribose)pol_cat_dom.
IPR004170. WWE-dom.
[Graphical view]
PfamiPF01661. Macro. 3 hits.
PF00644. PARP. 1 hit.
[Graphical view]
SMARTiSM00506. A1pp. 3 hits.
[Graphical view]
PROSITEiPS51154. MACRO. 3 hits.
PS51059. PARP_CATALYTIC. 1 hit.
PS50918. WWE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Guo J.H., Yu L.
    Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Ovary.
  2. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1560 (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1380-1801 (ISOFORMS 1/3/6).
    Tissue: Ovarian carcinoma, Teratocarcinoma and Trachea.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-266 (ISOFORM 1).
    Tissue: Trachea.
  5. "B-aggressive lymphoma family proteins have unique domains that modulate transcription and exhibit poly(ADP-ribose) polymerase activity."
    Aguiar R.C.T., Takeyama K., He C., Kreinbrink K., Shipp M.A.
    J. Biol. Chem. 280:33756-33765(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 160-1801 (ISOFORM 4), NUCLEOTIDE SEQUENCE [MRNA] OF 160-1801 (ISOFORM 1), ALTERNATIVE SPLICING, FUNCTION.
  6. "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.
    DNA Res. 6:337-345(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 658-1801 (ISOFORM 4).
    Tissue: Brain.
  7. "Toward a unified nomenclature for mammalian ADP-ribosyltransferases."
    Hottiger M.O., Hassa P.O., Luscher B., Schuler H., Koch-Nolte F.
    Trends Biochem. Sci. 35:208-219(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: NOMENCLATURE.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1403, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiPAR14_HUMAN
AccessioniPrimary (citable) accession number: Q460N5
Secondary accession number(s): B4E2H0
, Q460N4, Q8J027, Q9H9X9, Q9NV60, Q9ULF2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: April 5, 2011
Last modified: March 16, 2016
This is version 102 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.