Reviewed,
UniProtKB/Swiss-Prot Q460N5 (PAR14_HUMAN)
Last modified
January 19, 2010.
Version 43.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Poly [ADP-ribose] polymerase 14 Short name=PARP-14 EC=2.4.2.30 Alternative name(s): B aggressive lymphoma protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1720 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Enhances STAT6-dependent transcription By similarity. Has ADP-ribosyltransferase activity. Ref.1 |
| Catalytic activity | NAD+ + (ADP-D-ribosyl)(n)-acceptor = nicotinamide + (ADP-D-ribosyl)(n+1)-acceptor. |
| Subunit structure | Interacts with STAT6 By similarity. |
| Subcellular location | Nucleus. Cytoplasm. Note: In steady state cells the protein is mostly nuclear. A minor proportion is detected in the cytoplasm By similarity. |
| Sequence similarities | Contains 3 Macro domains. Contains 1 PARP catalytic domain. Contains 1 WWE domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Ligand | NAD |
| Molecular function | Glycosyltransferase Transferase |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | regulation of transcription Inferred from electronic annotation. Source: UniProtKB-KW transcriptionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytoplasm Inferred from direct assay. Source: HPA nucleusInferred from electronic annotation. Source: UniProtKB-SubCell plasma membraneInferred from direct assay. Source: HPA |
| Molecular function | NAD+ ADP-ribosyltransferase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q460N5-1) Also known as: BAL2B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q460N5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-82: Missing. 83-118: FKLTVQLPATPDEIDHVFEEELLTKESKTKEDVKEP → MLILLVENISGLSNDDFQVEIIRDFDVAVVTFQKHI | ||||||
| Isoform 3 (identifier: Q460N5-3) Also known as: BAL2A; The sequence of this isoform differs from the canonical sequence as follows: 1-202: Missing. | ||||||
| Isoform 4 (identifier: Q460N5-4) The sequence of this isoform differs from the canonical sequence as follows: 1-82: Missing. 83-118: FKLTVQLPATPDEIDHVFEEELLTKESKTKEDVKEP → MLILLVENISGLSNDDFQVEIIRDFDVAVVTFQKHI 1567-1599: IERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQL → VSLLLECSFWMVEISSVMVLYKIHFHSLPITFF 1600-1720: Missing. | ||||||
| Isoform 5 (identifier: Q460N5-5) The sequence of this isoform differs from the canonical sequence as follows: 1-923: Missing. 924-932: KGSLVSPGG → MYLRRLLRP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1720 | 1720 | Poly [ADP-ribose] polymerase 14 | PRO_0000247589 | ||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||
| Domain | 710 – 897 | 188 | Macro 1 | |||||||||||||||||||||||||||||||||||
| Domain | 922 – 1109 | 188 | Macro 2 | |||||||||||||||||||||||||||||||||||
| Domain | 1135 – 1306 | 172 | Macro 3 | |||||||||||||||||||||||||||||||||||
| Domain | 1442 – 1520 | 79 | WWE | |||||||||||||||||||||||||||||||||||
| Domain | 1524 – 1720 | 197 | PARP catalytic | |||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 923 | 923 | Missing in isoform 5. | VSP_020013 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 202 | 202 | Missing in isoform 3. | VSP_020014 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 82 | 82 | Missing in isoform 2 and isoform 4. | VSP_020015 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 83 – 118 | 36 | FKLTV…DVKEP → MLILLVENISGLSNDDFQVE IIRDFDVAVVTFQKHI in isoform 2 and isoform 4. | VSP_020016 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 924 – 932 | 9 | KGSLVSPGG → MYLRRLLRP in isoform 5. | VSP_020017 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1567 – 1599 | 33 | IERIQ…NEKQL → VSLLLECSFWMVEISSVMVL YKIHFHSLPITFF in isoform 4. | VSP_020018 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1600 – 1720 | 121 | Missing in isoform 4. | VSP_020019 | ||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1158 | 1 | E → G in BAA91897. Ref.3 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1418 | 1 | G → A in AAN08627. Ref.2 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1440 | 1 | A → G in AAN08627. Ref.2 | |||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 1537 – 1540 | 4 | ||||||||||||||||||||||||||||||||||||
| Helix | 1546 – 1550 | 5 | ||||||||||||||||||||||||||||||||||||
| Helix | 1556 – 1559 | 4 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1564 – 1571 | 8 | ||||||||||||||||||||||||||||||||||||
| Helix | 1573 – 1589 | 17 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1596 – 1601 | 6 | ||||||||||||||||||||||||||||||||||||
| Helix | 1608 – 1613 | 6 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1633 – 1637 | 5 | ||||||||||||||||||||||||||||||||||||
| Helix | 1638 – 1642 | 5 | ||||||||||||||||||||||||||||||||||||
| Turn | 1644 – 1646 | 3 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1655 – 1663 | 9 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1682 – 1684 | 3 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1690 – 1694 | 5 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1700 – 1703 | 4 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1709 – 1718 | 10 | ||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "B-aggressive lymphoma family proteins have unique domains that modulate transcription and exhibit poly(ADP-ribose) polymerase activity." Aguiar R.C.T., Takeyama K., He C., Kreinbrink K., Shipp M.A. J. Biol. Chem. 280:33756-33765(2005) [PubMed: 16061477] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 4), ALTERNATIVE SPLICING, FUNCTION. |
| [2] | Guo J.H., Yu L. Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Ovary. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-185 AND 1299-1720 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1479 (ISOFORM 5). Tissue: Ovarian carcinoma, Teratocarcinoma and Trachea. |
| [4] | "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O. DNA Res. 6:337-345(1999) [PubMed: 10574462] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 577-1720 (ISOFORM 4). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | DQ063584 mRNA. Translation: AAY64449.1. DQ063585 mRNA. Translation: AAY64450.1. AY134858 mRNA. Translation: AAN08627.1. AK001770 mRNA. Translation: BAA91897.1. AK022542 mRNA. Translation: BAB14089.1. Different initiation. DB237115 mRNA. No translation available. AB033094 mRNA. Translation: BAA86582.1. | ||||||||||||
| IPI | IPI00291215. IPI00783216. IPI00783683. IPI00783883. IPI00784370. | ||||||||||||
| RefSeq | NP_060024.2. | ||||||||||||
| UniGene | Hs.518203 | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| SMR | Q460N5. Positions 708-897, 875-1081, 937-1108, 1386-1719. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | Q460N5. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q460N5. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q460N5. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000398162; ENSP00000381228; ENSG00000173193; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 54625. | ||||||||||||
| KEGG | hsa:54625. | ||||||||||||
| UCSC | uc003efq.2. human. uc003efs.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 54625. | ||||||||||||
| GeneCards | GC03P123897. | ||||||||||||
| H-InvDB | HIX0019605. | ||||||||||||
| HGNC | HGNC:29232. PARP14. | ||||||||||||
| HPA | HPA008846. HPA012063. | ||||||||||||
| MIM | 610028. gene. | ||||||||||||
| PharmGKB | PA134861585. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG19122. | ||||||||||||
| HOVERGEN | Q460N5. | ||||||||||||
| InParanoid | Q460N5. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| BRENDA | 2.4.2.30. 247. | ||||||||||||
| Pathway_Interaction_DB | il4_2pathway. IL4-mediated signaling events. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q460N5. | ||||||||||||
| Bgee | Q460N5. | ||||||||||||
| CleanEx | HS_PARP14. | ||||||||||||
| Genevestigator | Q460N5. | ||||||||||||
| GermOnline | ENSG00000173193. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR002589. A1pp. IPR012317. Poly(ADP-ribose)pol_cat_dom. IPR004170. WWE-dom. [Graphical view] | ||||||||||||
| Pfam | PF01661. Macro. 3 hits. PF00644. PARP. 1 hit. PF02825. WWE. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00506. A1pp. 3 hits. [Graphical view] | ||||||||||||
| PROSITE | PS51154. MACRO. 3 hits. PS51059. PARP_CATALYTIC. 1 hit. PS50918. WWE. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 57162. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | PAR14_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q460N5 Secondary accession number(s): Q460N4 Q9ULF2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


