Q460N5 (PAR14_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 61.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Poly [ADP-ribose] polymerase 14 Short name=PARP-14 EC=2.4.2.30 Alternative name(s): B aggressive lymphoma protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1801 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Enhances STAT6-dependent transcription By similarity. Has ADP-ribosyltransferase activity. Ref.5 |
| Catalytic activity | NAD+ + (ADP-D-ribosyl)(n)-acceptor = nicotinamide + (ADP-D-ribosyl)(n+1)-acceptor. |
| Subunit structure | Interacts with STAT6 By similarity. |
| Subcellular location | Nucleus. Cytoplasm. Note: In steady state cells the protein is mostly nuclear. A minor proportion is detected in the cytoplasm By similarity. |
| Sequence similarities | Contains 3 Macro domains. Contains 1 PARP catalytic domain. Contains 1 WWE domain. |
| Sequence caution | The sequence AAY64449.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAY64450.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB14089.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence DB237115 differs from that shown. Reason: Frameshift at position 48. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Ligand | NAD |
| Molecular function | Glycosyltransferase Transferase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | regulation of transcription, DNA-dependent Inferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytoplasm Inferred from direct assay. Source: HPA nucleusInferred from electronic annotation. Source: UniProtKB-SubCell plasma membraneInferred from direct assay. Source: HPA |
| Molecular function | NAD+ ADP-ribosyltransferase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 6 (identifier: Q460N5-6) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q460N5-1) Also known as: BAL2B; The sequence of this isoform differs from the canonical sequence as follows: 119-199: Missing. | ||||||
| Isoform 3 (identifier: Q460N5-3) Also known as: BAL2A; The sequence of this isoform differs from the canonical sequence as follows: 1-283: Missing. | ||||||
| Isoform 4 (identifier: Q460N5-4) The sequence of this isoform differs from the canonical sequence as follows: 1648-1680: IERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQL → VSLLLECSFWMVEISSVMVLYKIHFHSLPITFF 1681-1801: Missing. | ||||||
| Isoform 5 (identifier: Q460N5-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1004: Missing. 1005-1013: KGSLVSPGG → MYLRRLLRP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1801 | 1801 | Poly [ADP-ribose] polymerase 14 | PRO_0000247589 | ||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||
| Domain | 791 – 978 | 188 | Macro 1 | |||||||||||||||||||||||||||||||||||
| Domain | 1003 – 1190 | 188 | Macro 2 | |||||||||||||||||||||||||||||||||||
| Domain | 1216 – 1387 | 172 | Macro 3 | |||||||||||||||||||||||||||||||||||
| Domain | 1523 – 1601 | 79 | WWE | |||||||||||||||||||||||||||||||||||
| Domain | 1605 – 1801 | 197 | PARP catalytic | |||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 1004 | 1004 | Missing in isoform 5. | VSP_020013 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 283 | 283 | Missing in isoform 3. | VSP_020014 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 119 – 199 | 81 | Missing in isoform 1. | VSP_040876 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1005 – 1013 | 9 | KGSLVSPGG → MYLRRLLRP in isoform 5. | VSP_020017 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1648 – 1680 | 33 | IERIQ…NEKQL → VSLLLECSFWMVEISSVMVL YKIHFHSLPITFF in isoform 4. | VSP_020018 | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1681 – 1801 | 121 | Missing in isoform 4. | VSP_020019 | ||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 59 | 1 | Y → C in DB237115. Ref.4 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 597 | 1 | N → D in BAG65132. Ref.3 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1239 | 1 | E → G in BAA91897. Ref.3 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1499 | 1 | G → A in AAN08627. Ref.1 | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 1521 | 1 | A → G in AAN08627. Ref.1 | |||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 1618 – 1621 | 4 | ||||||||||||||||||||||||||||||||||||
| Helix | 1627 – 1631 | 5 | ||||||||||||||||||||||||||||||||||||
| Helix | 1637 – 1640 | 4 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1645 – 1652 | 8 | ||||||||||||||||||||||||||||||||||||
| Helix | 1654 – 1670 | 17 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1677 – 1682 | 6 | ||||||||||||||||||||||||||||||||||||
| Helix | 1689 – 1694 | 6 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1714 – 1718 | 5 | ||||||||||||||||||||||||||||||||||||
| Helix | 1719 – 1723 | 5 | ||||||||||||||||||||||||||||||||||||
| Turn | 1725 – 1727 | 3 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1736 – 1744 | 9 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1763 – 1765 | 3 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1771 – 1775 | 5 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1781 – 1784 | 4 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 1790 – 1799 | 10 | ||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Guo J.H., Yu L. Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Ovary. |
| [2] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1560 (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1380-1801 (ISOFORMS 1/3/6). Tissue: Ovarian carcinoma, Teratocarcinoma and Trachea. |
| [4] | "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." Kimura K., Wakamatsu A., Suzuki Y., Ota T., Nishikawa T., Yamashita R., Yamamoto J., Sekine M., Tsuritani K., Wakaguri H., Ishii S., Sugiyama T., Saito K., Isono Y., Irie R., Kushida N., Yoneyama T., Otsuka R. Sugano S.Genome Res. 16:55-65(2006) [PubMed: 16344560] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-266 (ISOFORM 1). Tissue: Trachea. |
| [5] | "B-aggressive lymphoma family proteins have unique domains that modulate transcription and exhibit poly(ADP-ribose) polymerase activity." Aguiar R.C.T., Takeyama K., He C., Kreinbrink K., Shipp M.A. J. Biol. Chem. 280:33756-33765(2005) [PubMed: 16061477] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 160-1801 (ISOFORM 4), NUCLEOTIDE SEQUENCE [MRNA] OF 160-1801 (ISOFORM 1), ALTERNATIVE SPLICING, FUNCTION. |
| [6] | "Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O. DNA Res. 6:337-345(1999) [PubMed: 10574462] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 658-1801 (ISOFORM 4). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY134858 mRNA. Translation: AAN08627.1. AC048348 Genomic DNA. No translation available. AC092908 Genomic DNA. No translation available. AK001770 mRNA. Translation: BAA91897.1. AK022542 mRNA. Translation: BAB14089.1. Different initiation. AK304269 mRNA. Translation: BAG65132.1. DB237115 mRNA. No translation available. DQ063584 mRNA. Translation: AAY64449.1. Different initiation. DQ063585 mRNA. Translation: AAY64450.1. Different initiation. AB033094 mRNA. Translation: BAA86582.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00291215. IPI00783216. IPI00783683. IPI00783883. IPI00784370. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_060024.2. NM_017554.2. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.518203. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q460N5. | ||||||||||||||||||||||||||||||||||||||||||
| SMR | Q460N5. Positions 792-978, 999-1191, 1220-1387, 1614-1801. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| STRING | Q460N5. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q460N5. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 110815960. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q460N5. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000398162; ENSP00000381228; ENSG00000173193. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 54625. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:54625. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003efq.2. human. uc003efs.1. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 54625. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC03P122399. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:29232. PARP14. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA008846. HPA012063. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 610028. gene. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q460N5. | ||||||||||||||||||||||||||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG19122. | ||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00600000084200. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG082105. | ||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q460N5. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | YELEGTT. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| BRENDA | 2.4.2.30. 2681. | ||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | il4_2pathway. IL4-mediated signaling events. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q460N5. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q460N5. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_PARP14. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q460N5. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000173193. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR002589. A1pp. IPR012317. Poly(ADP-ribose)pol_cat_dom. IPR004170. WWE-dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| KO | K15261. | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF01661. Macro. 3 hits. PF00644. PARP. 1 hit. PF02825. WWE. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00506. A1pp. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS51154. MACRO. 3 hits. PS51059. PARP_CATALYTIC. 1 hit. PS50918. WWE. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| NextBio | 57162. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | PAR14_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q460N5 Secondary accession number(s): B4E2H0 Q9ULF2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with