Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Poly [ADP-ribose] polymerase 14

Gene

PARP14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

ADP-ribosyltransferase (PubMed:16061477, PubMed:27796300). By mono-ADP-ribosylating STAT1 at 'Glu-657' and 'Glu-705' and thus decreasing STAT1 phosphorylation, negatively regulates pro-inflammatory cytokines production in macrophages in response to IFNG stimulation (PubMed:27796300). Mono-ADP-ribosylates STAT6 (By similarity). Enhances STAT6-dependent transcription (By similarity). In macrophages, positively regulates MRC1 expression in response to IL4 stimulation by promoting STAT6 phosphorylation (PubMed:27796300). Mono-ADP-ribosylates PARP9 (PubMed:27796300).By similarity2 Publications

Catalytic activityi

NAD+ + (ADP-D-ribosyl)(n)-acceptor = nicotinamide + (ADP-D-ribosyl)(n+1)-acceptor.PROSITE-ProRule annotation2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei824Substrate 1Combined sources1 Publication1
Binding sitei833Substrate 1; via amide nitrogenCombined sources1 Publication1
Binding sitei961Substrate 1Combined sources1 Publication1
Binding sitei1034Substrate 2Combined sources1 Publication1
Binding sitei1247Substrate 3Combined sources1 Publication1
Binding sitei1258Substrate 3; via amide nitrogenCombined sources1 Publication1
Binding sitei1371Substrate 3Combined sources1 Publication1

GO - Molecular functioni

  • enzyme binding Source: UniProtKB
  • NAD+ ADP-ribosyltransferase activity Source: UniProtKB
  • NAD+ binding Source: UniProtKB
  • RNA binding Source: InterPro

GO - Biological processi

  • negative regulation of gene expression Source: UniProtKB
  • negative regulation of interferon-gamma-mediated signaling pathway Source: UniProtKB
  • negative regulation of tyrosine phosphorylation of STAT protein Source: UniProtKB
  • positive regulation of interleukin-4-mediated signaling pathway Source: UniProtKB
  • positive regulation of tyrosine phosphorylation of STAT protein Source: UniProtKB
  • protein ADP-ribosylation Source: UniProtKB
  • protein poly-ADP-ribosylation Source: UniProtKB
  • regulation of transcription, DNA-templated Source: UniProtKB-KW
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionGlycosyltransferase, Transferase
Biological processImmunity, Innate immunity, Transcription, Transcription regulation
LigandNAD

Enzyme and pathway databases

BRENDAi2.4.2.30. 2681.
ReactomeiR-HSA-197264. Nicotinamide salvaging.

Names & Taxonomyi

Protein namesi
Recommended name:
Poly [ADP-ribose] polymerase 14 (EC:2.4.2.30PROSITE-ProRule annotation2 Publications)
Short name:
PARP-14
Alternative name(s):
ADP-ribosyltransferase diphtheria toxin-like 8
Short name:
ARTD8
B aggressive lymphoma protein 2
Gene namesi
Name:PARP14
Synonyms:BAL2, KIAA1268
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000173193.13.
HGNCiHGNC:29232. PARP14.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1055G → E: Abolishes interaction with PARP10. 1 Publication1

Organism-specific databases

DisGeNETi54625.
OpenTargetsiENSG00000173193.
PharmGKBiPA134861585.

Chemistry databases

ChEMBLiCHEMBL2176777.

Polymorphism and mutation databases

BioMutaiPARP14.
DMDMi327478567.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002475891 – 1801Poly [ADP-ribose] polymerase 14Add BLAST1801

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei33PhosphoserineCombined sources1
Modified residuei1403PhosphoserineCombined sources1
Modified residuei1411PhosphoserineCombined sources1

Post-translational modificationi

Auto-ADP-ribosylated.2 Publications

Keywords - PTMi

ADP-ribosylation, Phosphoprotein

Proteomic databases

EPDiQ460N5.
MaxQBiQ460N5.
PaxDbiQ460N5.
PeptideAtlasiQ460N5.
PRIDEiQ460N5.

PTM databases

iPTMnetiQ460N5.
PhosphoSitePlusiQ460N5.

Expressioni

Tissue specificityi

Expressed in macrophages.1 Publication

Inductioni

Up-regulated by IFNG in macrophages. Down-regulated by IL4 in macrophages.1 Publication

Gene expression databases

BgeeiENSG00000173193.
CleanExiHS_PARP14.
ExpressionAtlasiQ460N5. baseline and differential.
GenevisibleiQ460N5. HS.

Organism-specific databases

HPAiHPA008846.
HPA012063.

Interactioni

Subunit structurei

Interacts with STAT6 (By similarity). Interacts with PARP10 (PubMed:23473667). Interacts with PARP9 in IFNG-stimulated macrophages; the interaction prevents PARP14-mediated STAT1 and STAT6 ADP-riboslylation (PubMed:27796300).By similarity2 Publications

GO - Molecular functioni

  • enzyme binding Source: UniProtKB

Protein-protein interaction databases

BioGridi120082. 13 interactors.
DIPiDIP-61130N.
IntActiQ460N5. 1 interactor.
STRINGi9606.ENSP00000418194.

Chemistry databases

BindingDBiQ460N5.

Structurei

Secondary structure

11801
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi792 – 799Combined sources8
Beta strandi802 – 808Combined sources7
Beta strandi815 – 823Combined sources9
Helixi832 – 841Combined sources10
Helixi844 – 856Combined sources13
Beta strandi861 – 868Combined sources8
Beta strandi872 – 881Combined sources10
Helixi887 – 889Combined sources3
Helixi890 – 910Combined sources21
Beta strandi914 – 918Combined sources5
Turni921 – 926Combined sources6
Helixi930 – 947Combined sources18
Beta strandi956 – 963Combined sources8
Helixi964 – 977Combined sources14
Beta strandi1007 – 1009Combined sources3
Beta strandi1015 – 1019Combined sources5
Helixi1023 – 1025Combined sources3
Beta strandi1028 – 1034Combined sources7
Beta strandi1041 – 1044Combined sources4
Helixi1045 – 1054Combined sources10
Helixi1057 – 1066Combined sources10
Beta strandi1076 – 1080Combined sources5
Beta strandi1084 – 1092Combined sources9
Helixi1098 – 1100Combined sources3
Helixi1102 – 1121Combined sources20
Beta strandi1126 – 1130Combined sources5
Helixi1141 – 1158Combined sources18
Beta strandi1166 – 1170Combined sources5
Helixi1176 – 1189Combined sources14
Beta strandi1213 – 1216Combined sources4
Beta strandi1220 – 1224Combined sources5
Beta strandi1227 – 1234Combined sources8
Helixi1236 – 1238Combined sources3
Beta strandi1242 – 1248Combined sources7
Helixi1258 – 1266Combined sources9
Helixi1268 – 1280Combined sources13
Beta strandi1284 – 1289Combined sources6
Beta strandi1293 – 1302Combined sources10
Helixi1307 – 1320Combined sources14
Beta strandi1325 – 1328Combined sources4
Helixi1340 – 1356Combined sources17
Beta strandi1365 – 1371Combined sources7
Helixi1373 – 1386Combined sources14
Beta strandi1617 – 1621Combined sources5
Helixi1629 – 1640Combined sources12
Beta strandi1643 – 1652Combined sources10
Helixi1654 – 1670Combined sources17
Turni1671 – 1673Combined sources3
Beta strandi1677 – 1684Combined sources8
Helixi1686 – 1688Combined sources3
Helixi1689 – 1695Combined sources7
Turni1699 – 1701Combined sources3
Helixi1704 – 1706Combined sources3
Beta strandi1707 – 1709Combined sources3
Beta strandi1713 – 1718Combined sources6
Helixi1719 – 1722Combined sources4
Turni1725 – 1727Combined sources3
Beta strandi1736 – 1744Combined sources9
Beta strandi1747 – 1750Combined sources4
Beta strandi1760 – 1762Combined sources3
Beta strandi1763 – 1765Combined sources3
Beta strandi1771 – 1775Combined sources5
Beta strandi1777 – 1779Combined sources3
Beta strandi1781 – 1785Combined sources5
Beta strandi1791 – 1800Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3GOYX-ray2.80A/B/C/D1611-1801[»]
3Q6ZX-ray2.23A789-979[»]
3Q71X-ray2.20A999-1196[»]
3SE2X-ray2.30A/B/C/D1611-1801[»]
3SMIX-ray2.40A/B1611-1801[»]
3SMJX-ray1.50A/B1611-1801[»]
3VFQX-ray2.80A784-1196[»]
4ABKX-ray1.60A1208-1388[»]
4ABLX-ray1.15A1208-1388[»]
4D86X-ray2.00A784-1196[»]
4F1LX-ray1.90A/B/C/D1611-1801[»]
4F1QX-ray2.80A/B1611-1801[»]
4PY4X-ray2.76A/B1613-1801[»]
5LXPX-ray2.07A/B1611-1801[»]
5LYHX-ray2.17A/B1611-1801[»]
5NQEX-ray2.71A/B1611-1801[»]
5V7TX-ray2.30A1610-1801[»]
5V7WX-ray2.65A/B1610-1801[»]
ProteinModelPortaliQ460N5.
SMRiQ460N5.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ460N5.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini791 – 978Macro 1PROSITE-ProRule annotationAdd BLAST188
Domaini1003 – 1190Macro 2PROSITE-ProRule annotationAdd BLAST188
Domaini1216 – 1387Macro 3PROSITE-ProRule annotationAdd BLAST172
Domaini1523 – 1601WWEPROSITE-ProRule annotationAdd BLAST79
Domaini1605 – 1801PARP catalyticPROSITE-ProRule annotationAdd BLAST197

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni922 – 926Substrate 1 bindingCombined sources1 Publication5
Regioni1023 – 1024Substrate 2 bindingCombined sources1 Publication2
Regioni1046 – 1049Substrate 2 bindingCombined sources1 Publication4
Regioni1133 – 1137Substrate 2 bindingCombined sources1 Publication5
Regioni1175 – 1178Substrate 2 bindingCombined sources1 Publication4
Regioni1235 – 1236Substrate 3 bindingCombined sources1 Publication2
Regioni1332 – 1336Substrate 3 bindingCombined sources1 Publication5

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG2633. Eukaryota.
COG2110. LUCA.
GeneTreeiENSGT00760000119084.
HOVERGENiHBG082105.
InParanoidiQ460N5.
KOiK15261.
OMAiHHVIHAV.
OrthoDBiEOG091G00EB.
PhylomeDBiQ460N5.
TreeFamiTF328965.

Family and domain databases

CDDicd12543. RRM2_PAR14. 1 hit.
Gene3Di3.30.1370.10. 1 hit.
InterProiView protein in InterPro
IPR036612. KH_dom_type_1_sf.
IPR002589. Macro_dom.
IPR034517. PAR14_RRM2.
IPR012317. Poly(ADP-ribose)pol_cat_dom.
IPR004170. WWE-dom.
IPR037197. WWE_dom_sf.
PfamiView protein in Pfam
PF01661. Macro. 3 hits.
PF00644. PARP. 1 hit.
SMARTiView protein in SMART
SM00506. A1pp. 3 hits.
SUPFAMiSSF117839. SSF117839. 1 hit.
PROSITEiView protein in PROSITE
PS51154. MACRO. 3 hits.
PS51059. PARP_CATALYTIC. 1 hit.
PS50918. WWE. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 6 (identifier: Q460N5-6) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVPGSFPLL VEGSWGPDPP KNLNTKLQMY FQSPKRSGGG ECEVRQDPRS
60 70 80 90 100
PSRFLVFFYP EDVRQKVLER KNHELVWQGK GTFKLTVQLP ATPDEIDHVF
110 120 130 140 150
EEELLTKESK TKEDVKEPDV SEELDTKLPL DGGLDKMEDI PEECENISSL
160 170 180 190 200
VAFENLKANV TDIMLILLVE NISGLSNDDF QVEIIRDFDV AVVTFQKHID
210 220 230 240 250
TIRFVDDCTK HHSIKQLQLS PRLLEVTNTI RVENLPPGAD DYSLKLFFEN
260 270 280 290 300
PYNGGGRVAN VEYFPEESSA LIEFFDRKVL DTIMATKLDF NKMPLSVFPY
310 320 330 340 350
YASLGTALYG KEKPLIKLPA PFEESLDLPL WKFLQKKNHL IEEINDEMRR
360 370 380 390 400
CHCELTWSQL SGKVTIRPAA TLVNEGRPRI KTWQADTSTT LSSIRSKYKV
410 420 430 440 450
NPIKVDPTMW DTIKNDVKDD RILIEFDTLK EMVILAGKSE DVQSIEVQVR
460 470 480 490 500
ELIESTTQKI KREEQSLKEK MIISPGRYFL LCHSSLLDHL LTECPEIEIC
510 520 530 540 550
YDRVTQHLCL KGPSADVYKA KCEIQEKVYT MAQKNIQVSP EIFQFLQQVN
560 570 580 590 600
WKEFSKCLFI AQKILALYEL EGTTVLLTSC SSEALLEAEK QMLSALNYKR
610 620 630 640 650
IEVENKEVLH GKKWKGLTHN LLKKQNSSPN TVIINELTSE TTAEVIITGC
660 670 680 690 700
VKEVNETYKL LFNFVEQNMK IERLVEVKPS LVIDYLKTEK KLFWPKIKKV
710 720 730 740 750
NVQVSFNPEN KQKGILLTGS KTEVLKAVDI VKQVWDSVCV KSVHTDKPGA
760 770 780 790 800
KQFFQDKARF YQSEIKRLFG CYIELQENEV MKEGGSPAGQ KCFSRTVLAP
810 820 830 840 850
GVVLIVQQGD LARLPVDVVV NASNEDLKHY GGLAAALSKA AGPELQADCD
860 870 880 890 900
QIVKREGRLL PGNATISKAG KLPYHHVIHA VGPRWSGYEA PRCVYLLRRA
910 920 930 940 950
VQLSLCLAEK YKYRSIAIPA ISSGVFGFPL GRCVETIVSA IKENFQFKKD
960 970 980 990 1000
GHCLKEIYLV DVSEKTVEAF AEAVKTVFKA TLPDTAAPPG LPPAAAGPGK
1010 1020 1030 1040 1050
TSWEKGSLVS PGGLQMLLVK EGVQNAKTDV VVNSVPLDLV LSRGPLSKSL
1060 1070 1080 1090 1100
LEKAGPELQE ELDTVGQGVA VSMGTVLKTS SWNLDCRYVL HVVAPEWRNG
1110 1120 1130 1140 1150
STSSLKIMED IIRECMEITE SLSLKSIAFP AIGTGNLGFP KNIFAELIIS
1160 1170 1180 1190 1200
EVFKFSSKNQ LKTLQEVHFL LHPSDHENIQ AFSDEFARRA NGNLVSDKIP
1210 1220 1230 1240 1250
KAKDTQGFYG TVSSPDSGVY EMKIGSIIFQ VASGDITKEE ADVIVNSTSN
1260 1270 1280 1290 1300
SFNLKAGVSK AILECAGQNV ERECSQQAQQ RKNDYIITGG GFLRCKNIIH
1310 1320 1330 1340 1350
VIGGNDVKSS VSSVLQECEK KNYSSICLPA IGTGNAKQHP DKVAEAIIDA
1360 1370 1380 1390 1400
IEDFVQKGSA QSVKKVKVVI FLPQVLDVFY ANMKKREGTQ LSSQQSVMSK
1410 1420 1430 1440 1450
LASFLGFSKQ SPQKKNHLVL EKKTESATFR VCGENVTCVE YAISWLQDLI
1460 1470 1480 1490 1500
EKEQCPYTSE DECIKDFDEK EYQELNELQK KLNINISLDH KRPLIKVLGI
1510 1520 1530 1540 1550
SRDVMQARDE IEAMIKRVRL AKEQESRADC ISEFIEWQYN DNNTSHCFNK
1560 1570 1580 1590 1600
MTNLKLEDAR REKKKTVDVK INHRHYTVNL NTYTATDTKG HSLSVQRLTK
1610 1620 1630 1640 1650
SKVDIPAHWS DMKQQNFCVV ELLPSDPEYN TVASKFNQTC SHFRIEKIER
1660 1670 1680 1690 1700
IQNPDLWNSY QAKKKTMDAK NGQTMNEKQL FHGTDAGSVP HVNRNGFNRS
1710 1720 1730 1740 1750
YAGKNAVAYG KGTYFAVNAN YSANDTYSRP DANGRKHVYY VRVLTGIYTH
1760 1770 1780 1790 1800
GNHSLIVPPS KNPQNPTDLY DTVTDNVHHP SLFVAFYDYQ AYPEYLITFR

K
Length:1,801
Mass (Da):202,800
Last modified:April 5, 2011 - v3
Checksum:i27B027DFC7E773BD
GO
Isoform 1 (identifier: Q460N5-1) [UniParc]FASTAAdd to basket
Also known as: BAL2B

The sequence of this isoform differs from the canonical sequence as follows:
     119-199: Missing.

Show »
Length:1,720
Mass (Da):193,753
Checksum:iF7EAD232767F2867
GO
Isoform 3 (identifier: Q460N5-3) [UniParc]FASTAAdd to basket
Also known as: BAL2A

The sequence of this isoform differs from the canonical sequence as follows:
     1-283: Missing.

Show »
Length:1,518
Mass (Da):170,601
Checksum:i8B8D7BFCB9682902
GO
Isoform 4 (identifier: Q460N5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1648-1680: IERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQL → VSLLLECSFWMVEISSVMVLYKIHFHSLPITFF
     1681-1801: Missing.

Show »
Length:1,680
Mass (Da):189,177
Checksum:iBCDDC89D51466E28
GO
Isoform 5 (identifier: Q460N5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1004: Missing.
     1005-1013: KGSLVSPGG → MYLRRLLRP

Show »
Length:797
Mass (Da):89,790
Checksum:i978947F6DF05569E
GO

Sequence cautioni

The sequence AAY64449 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAY64450 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB14089 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence DB237115 differs from that shown. Reason: Frameshift at position 48.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti59Y → C in DB237115 (PubMed:16344560).Curated1
Sequence conflicti597N → D in BAG65132 (PubMed:14702039).Curated1
Sequence conflicti1239E → G in BAA91897 (PubMed:14702039).Curated1
Sequence conflicti1499G → A in AAN08627 (Ref. 1) Curated1
Sequence conflicti1521A → G in AAN08627 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0200131 – 1004Missing in isoform 5. 1 PublicationAdd BLAST1004
Alternative sequenceiVSP_0200141 – 283Missing in isoform 3. 1 PublicationAdd BLAST283
Alternative sequenceiVSP_040876119 – 199Missing in isoform 1. 3 PublicationsAdd BLAST81
Alternative sequenceiVSP_0200171005 – 1013KGSLVSPGG → MYLRRLLRP in isoform 5. 1 Publication9
Alternative sequenceiVSP_0200181648 – 1680IERIQ…NEKQL → VSLLLECSFWMVEISSVMVL YKIHFHSLPITFF in isoform 4. 2 PublicationsAdd BLAST33
Alternative sequenceiVSP_0200191681 – 1801Missing in isoform 4. 2 PublicationsAdd BLAST121

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY134858 mRNA. Translation: AAN08627.1.
AC048348 Genomic DNA. No translation available.
AC092908 Genomic DNA. No translation available.
AK001770 mRNA. Translation: BAA91897.1.
AK022542 mRNA. Translation: BAB14089.1. Different initiation.
AK304269 mRNA. Translation: BAG65132.1.
DB237115 mRNA. No translation available.
DQ063584 mRNA. Translation: AAY64449.1. Different initiation.
DQ063585 mRNA. Translation: AAY64450.1. Different initiation.
AB033094 mRNA. Translation: BAA86582.1.
CCDSiCCDS46894.1. [Q460N5-6]
RefSeqiNP_060024.2. NM_017554.2. [Q460N5-6]
UniGeneiHs.518203.

Genome annotation databases

EnsembliENST00000474629; ENSP00000418194; ENSG00000173193. [Q460N5-6]
GeneIDi54625.
KEGGihsa:54625.
UCSCiuc003efq.5. human. [Q460N5-6]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPAR14_HUMAN
AccessioniPrimary (citable) accession number: Q460N5
Secondary accession number(s): B4E2H0
, Q460N4, Q8J027, Q9H9X9, Q9NV60, Q9ULF2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: April 5, 2011
Last modified: November 22, 2017
This is version 117 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references