Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q42527

- PAI2_ARATH

UniProt

Q42527 - PAI2_ARATH

Protein

N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic

Gene

PAI2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 109 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    N-(5-phospho-beta-D-ribosyl)anthranilate = 1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate.

    Pathwayi

    GO - Molecular functioni

    1. phosphoribosylanthranilate isomerase activity Source: TAIR

    GO - Biological processi

    1. tryptophan biosynthetic process Source: TAIR

    Keywords - Molecular functioni

    Isomerase

    Keywords - Biological processi

    Amino-acid biosynthesis, Aromatic amino acid biosynthesis, Tryptophan biosynthesis

    Enzyme and pathway databases

    BioCyciARA:AT5G05590-MONOMER.
    UniPathwayiUPA00035; UER00042.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic (EC:5.3.1.24)
    Gene namesi
    Name:PAI2
    Ordered Locus Names:At5g05590
    ORF Names:MOP10.13
    OrganismiArabidopsis thaliana (Mouse-ear cress)
    Taxonomic identifieri3702 [NCBI]
    Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
    ProteomesiUP000006548: Chromosome 5

    Organism-specific databases

    TAIRiAT5G05590.

    Subcellular locationi

    Plastidchloroplast 1 Publication

    GO - Cellular componenti

    1. chloroplast Source: UniProtKB

    Keywords - Cellular componenti

    Chloroplast, Plastid

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transit peptidei1 – 3232ChloroplastSequence AnalysisAdd
    BLAST
    Chaini33 – 275243N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplasticPRO_0000417454Add
    BLAST

    Proteomic databases

    PRIDEiQ42527.

    Expressioni

    Tissue specificityi

    Expressed in roots and shoots.1 Publication

    Inductioni

    By silver nitrate and UV irradiation.1 Publication

    Gene expression databases

    GenevestigatoriQ42527.

    Structurei

    3D structure databases

    ProteinModelPortaliQ42527.
    SMRiQ42527. Positions 68-273.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the TrpF family.Curated

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    HOGENOMiHOG000161598.
    InParanoidiQ42527.
    KOiK01817.
    OMAiKLINSPP.
    PhylomeDBiQ42527.

    Family and domain databases

    Gene3Di3.20.20.70. 1 hit.
    HAMAPiMF_00135. PRAI.
    InterProiIPR013785. Aldolase_TIM.
    IPR001240. PRAI_dom.
    IPR011060. RibuloseP-bd_barrel.
    [Graphical view]
    PfamiPF00697. PRAI. 1 hit.
    [Graphical view]
    SUPFAMiSSF51366. SSF51366. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q42527-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSTGISTDLH VHFGALNFSK TYKSGLSNRT VSFSRVGYAQ NRKLSCSVSN    50
    TENVAPKDDE RGKDRPLVKM CGITSARDAA MAVEAGADFI GMIIWPHSKR 100
    SISLSVAKDI SKVAREGGAK PVGVFVEDDD NTILRAADSS DLELVQLHGN 150
    GSRAAFSRLV RKRRVIYVLN ANQDGKLLNE VPEEDCHLAD WILVDSATGG 200
    SGHGFNWAQF KLPSVRSRNG WLLAGGINPT NVSEALSILQ PDGIDVSSGI 250
    CGTDGIQKDK SKISSFITAV RSVHY 275
    Length:275
    Mass (Da):29,619
    Last modified:November 1, 1996 - v1
    Checksum:iFF55DC899925F2C7
    GO
    Isoform 2 (identifier: Q42527-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         146-146: Q → QVLYILIDFDFALTKVIFSTLLTVDSYGFLQ
         201-225: SGHGFNWAQFKLPSVRSRNGWLLAG → RYQEQLFNFFRIVMYSLEEKFKQSL
         226-275: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:255
    Mass (Da):28,314
    Checksum:iFF8F1A55B2944244
    GO

    Sequence cautioni

    The sequence BX829410 differs from that shown. Reason: Sequencing errors.
    The sequence BAB11548.1 differs from that shown. Reason: Erroneous gene model prediction.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei146 – 1461Q → QVLYILIDFDFALTKVIFST LLTVDSYGFLQ in isoform 2. CuratedVSP_043742
    Alternative sequencei201 – 22525SGHGF…WLLAG → RYQEQLFNFFRIVMYSLEEK FKQSL in isoform 2. CuratedVSP_043743Add
    BLAST
    Alternative sequencei226 – 27550Missing in isoform 2. CuratedVSP_043744Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U18968 Genomic DNA. Translation: AAC49003.1.
    AB005241 Genomic DNA. Translation: BAB11548.1. Sequence problems.
    CP002688 Genomic DNA. Translation: AED90894.1.
    CP002688 Genomic DNA. Translation: AED90895.1.
    BT003070 mRNA. Translation: AAO23635.1.
    AK227265 mRNA. Translation: BAE99293.1.
    BX829410 mRNA. No translation available.
    RefSeqiNP_196178.2. NM_120641.4. [Q42527-1]
    NP_974734.1. NM_203005.2. [Q42527-2]
    UniGeneiAt.273.
    At.48165.
    At.48988.

    Genome annotation databases

    EnsemblPlantsiAT5G05590.1; AT5G05590.1; AT5G05590. [Q42527-1]
    GeneIDi830442.
    KEGGiath:AT5G05590.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U18968 Genomic DNA. Translation: AAC49003.1 .
    AB005241 Genomic DNA. Translation: BAB11548.1 . Sequence problems.
    CP002688 Genomic DNA. Translation: AED90894.1 .
    CP002688 Genomic DNA. Translation: AED90895.1 .
    BT003070 mRNA. Translation: AAO23635.1 .
    AK227265 mRNA. Translation: BAE99293.1 .
    BX829410 mRNA. No translation available.
    RefSeqi NP_196178.2. NM_120641.4. [Q42527-1 ]
    NP_974734.1. NM_203005.2. [Q42527-2 ]
    UniGenei At.273.
    At.48165.
    At.48988.

    3D structure databases

    ProteinModelPortali Q42527.
    SMRi Q42527. Positions 68-273.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PRIDEi Q42527.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    EnsemblPlantsi AT5G05590.1 ; AT5G05590.1 ; AT5G05590 . [Q42527-1 ]
    GeneIDi 830442.
    KEGGi ath:AT5G05590.

    Organism-specific databases

    TAIRi AT5G05590.

    Phylogenomic databases

    HOGENOMi HOG000161598.
    InParanoidi Q42527.
    KOi K01817.
    OMAi KLINSPP.
    PhylomeDBi Q42527.

    Enzyme and pathway databases

    UniPathwayi UPA00035 ; UER00042 .
    BioCyci ARA:AT5G05590-MONOMER.

    Gene expression databases

    Genevestigatori Q42527.

    Family and domain databases

    Gene3Di 3.20.20.70. 1 hit.
    HAMAPi MF_00135. PRAI.
    InterProi IPR013785. Aldolase_TIM.
    IPR001240. PRAI_dom.
    IPR011060. RibuloseP-bd_barrel.
    [Graphical view ]
    Pfami PF00697. PRAI. 1 hit.
    [Graphical view ]
    SUPFAMi SSF51366. SSF51366. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Arabidopsis phosphoribosylanthranilate isomerase: molecular genetic analysis of triplicate tryptophan pathway genes."
      Li J., Zhao J., Rose A.B., Schmidt R., Last R.L.
      Plant Cell 7:447-461(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
      Strain: cv. Columbia.
    2. "Structural analysis of Arabidopsis thaliana chromosome 5. I. Sequence features of the 1.6 Mb regions covered by twenty physically assigned P1 clones."
      Sato S., Kotani H., Nakamura Y., Kaneko T., Asamizu E., Fukami M., Miyajima N., Tabata S.
      DNA Res. 4:215-230(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: cv. Columbia.
    3. The Arabidopsis Information Resource (TAIR)
      Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
      Cited for: GENOME REANNOTATION.
      Strain: cv. Columbia.
    4. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
      Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
      , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
      Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: cv. Columbia.
    5. "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs."
      Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.
      , Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y., Shinozaki K.
      Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: cv. Columbia.
    6. "Whole genome sequence comparisons and 'full-length' cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation."
      Castelli V., Aury J.-M., Jaillon O., Wincker P., Clepet C., Menard M., Cruaud C., Quetier F., Scarpelli C., Schaechter V., Temple G., Caboche M., Weissenbach J., Salanoubat M.
      Genome Res. 14:406-413(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM2).
      Strain: cv. Columbia.
    7. "Immunological characterization and chloroplast localization of the tryptophan biosynthetic enzymes of the flowering plant Arabidopsis thaliana."
      Zhao J., Last R.L.
      J. Biol. Chem. 270:6081-6087(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    8. "Differential expression of triplicate phosphoribosylanthranilate isomerase isogenes in the tryptophan biosynthetic pathway of Arabidopsis thaliana (L.) Heynh."
      He Y., Li J.
      Planta 212:641-647(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, INDUCTION.

    Entry informationi

    Entry nameiPAI2_ARATH
    AccessioniPrimary (citable) accession number: Q42527
    Secondary accession number(s): F4K0R4, Q9FFF7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 16, 2012
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 109 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programPlant Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Arabidopsis thaliana
      Arabidopsis thaliana: entries and gene names
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3