Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic

Gene

PAI2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

N-(5-phospho-beta-D-ribosyl)anthranilate = 1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate.

Pathwayi

GO - Molecular functioni

  1. phosphoribosylanthranilate isomerase activity Source: TAIR

GO - Biological processi

  1. tryptophan biosynthetic process Source: TAIR
Complete GO annotation...

Keywords - Molecular functioni

Isomerase

Keywords - Biological processi

Amino-acid biosynthesis, Aromatic amino acid biosynthesis, Tryptophan biosynthesis

Enzyme and pathway databases

BioCyciARA:AT5G05590-MONOMER.
UniPathwayiUPA00035; UER00042.

Names & Taxonomyi

Protein namesi
Recommended name:
N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic (EC:5.3.1.24)
Gene namesi
Name:PAI2
Ordered Locus Names:At5g05590
ORF Names:MOP10.13
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
ProteomesiUP000006548: Chromosome 5

Organism-specific databases

TAIRiAT5G05590.

Subcellular locationi

Plastidchloroplast 1 Publication

GO - Cellular componenti

  1. chloroplast Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Chloroplast, Plastid

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 3232ChloroplastSequence AnalysisAdd
BLAST
Chaini33 – 275243N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplasticPRO_0000417454Add
BLAST

Proteomic databases

PRIDEiQ42527.

Expressioni

Tissue specificityi

Expressed in roots and shoots.1 Publication

Inductioni

By silver nitrate and UV irradiation.1 Publication

Gene expression databases

GenevestigatoriQ42527.

Structurei

3D structure databases

ProteinModelPortaliQ42527.
SMRiQ42527. Positions 68-273.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the TrpF family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

HOGENOMiHOG000161598.
KOiK01817.
OMAiQDYFIAG.
PhylomeDBiQ42527.

Family and domain databases

Gene3Di3.20.20.70. 1 hit.
HAMAPiMF_00135. PRAI.
InterProiIPR013785. Aldolase_TIM.
IPR001240. PRAI_dom.
IPR011060. RibuloseP-bd_barrel.
[Graphical view]
PfamiPF00697. PRAI. 1 hit.
[Graphical view]
SUPFAMiSSF51366. SSF51366. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q42527-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTGISTDLH VHFGALNFSK TYKSGLSNRT VSFSRVGYAQ NRKLSCSVSN
60 70 80 90 100
TENVAPKDDE RGKDRPLVKM CGITSARDAA MAVEAGADFI GMIIWPHSKR
110 120 130 140 150
SISLSVAKDI SKVAREGGAK PVGVFVEDDD NTILRAADSS DLELVQLHGN
160 170 180 190 200
GSRAAFSRLV RKRRVIYVLN ANQDGKLLNE VPEEDCHLAD WILVDSATGG
210 220 230 240 250
SGHGFNWAQF KLPSVRSRNG WLLAGGINPT NVSEALSILQ PDGIDVSSGI
260 270
CGTDGIQKDK SKISSFITAV RSVHY
Length:275
Mass (Da):29,619
Last modified:November 1, 1996 - v1
Checksum:iFF55DC899925F2C7
GO
Isoform 2 (identifier: Q42527-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-146: Q → QVLYILIDFDFALTKVIFSTLLTVDSYGFLQ
     201-225: SGHGFNWAQFKLPSVRSRNGWLLAG → RYQEQLFNFFRIVMYSLEEKFKQSL
     226-275: Missing.

Note: No experimental confirmation available.

Show »
Length:255
Mass (Da):28,314
Checksum:iFF8F1A55B2944244
GO

Sequence cautioni

The sequence BAB11548.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence BX829410 differs from that shown.Sequencing errors.Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei146 – 1461Q → QVLYILIDFDFALTKVIFST LLTVDSYGFLQ in isoform 2. CuratedVSP_043742
Alternative sequencei201 – 22525SGHGF…WLLAG → RYQEQLFNFFRIVMYSLEEK FKQSL in isoform 2. CuratedVSP_043743Add
BLAST
Alternative sequencei226 – 27550Missing in isoform 2. CuratedVSP_043744Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U18968 Genomic DNA. Translation: AAC49003.1.
AB005241 Genomic DNA. Translation: BAB11548.1. Sequence problems.
CP002688 Genomic DNA. Translation: AED90894.1.
CP002688 Genomic DNA. Translation: AED90895.1.
BT003070 mRNA. Translation: AAO23635.1.
AK227265 mRNA. Translation: BAE99293.1.
BX829410 mRNA. No translation available.
RefSeqiNP_196178.2. NM_120641.4. [Q42527-1]
NP_974734.1. NM_203005.2. [Q42527-2]
UniGeneiAt.273.
At.48165.
At.48988.

Genome annotation databases

EnsemblPlantsiAT5G05590.1; AT5G05590.1; AT5G05590. [Q42527-1]
GeneIDi830442.
KEGGiath:AT5G05590.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U18968 Genomic DNA. Translation: AAC49003.1.
AB005241 Genomic DNA. Translation: BAB11548.1. Sequence problems.
CP002688 Genomic DNA. Translation: AED90894.1.
CP002688 Genomic DNA. Translation: AED90895.1.
BT003070 mRNA. Translation: AAO23635.1.
AK227265 mRNA. Translation: BAE99293.1.
BX829410 mRNA. No translation available.
RefSeqiNP_196178.2. NM_120641.4. [Q42527-1]
NP_974734.1. NM_203005.2. [Q42527-2]
UniGeneiAt.273.
At.48165.
At.48988.

3D structure databases

ProteinModelPortaliQ42527.
SMRiQ42527. Positions 68-273.
ModBaseiSearch...
MobiDBiSearch...

Proteomic databases

PRIDEiQ42527.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT5G05590.1; AT5G05590.1; AT5G05590. [Q42527-1]
GeneIDi830442.
KEGGiath:AT5G05590.

Organism-specific databases

TAIRiAT5G05590.

Phylogenomic databases

HOGENOMiHOG000161598.
KOiK01817.
OMAiQDYFIAG.
PhylomeDBiQ42527.

Enzyme and pathway databases

UniPathwayiUPA00035; UER00042.
BioCyciARA:AT5G05590-MONOMER.

Gene expression databases

GenevestigatoriQ42527.

Family and domain databases

Gene3Di3.20.20.70. 1 hit.
HAMAPiMF_00135. PRAI.
InterProiIPR013785. Aldolase_TIM.
IPR001240. PRAI_dom.
IPR011060. RibuloseP-bd_barrel.
[Graphical view]
PfamiPF00697. PRAI. 1 hit.
[Graphical view]
SUPFAMiSSF51366. SSF51366. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Arabidopsis phosphoribosylanthranilate isomerase: molecular genetic analysis of triplicate tryptophan pathway genes."
    Li J., Zhao J., Rose A.B., Schmidt R., Last R.L.
    Plant Cell 7:447-461(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Strain: cv. Columbia.
  2. "Structural analysis of Arabidopsis thaliana chromosome 5. I. Sequence features of the 1.6 Mb regions covered by twenty physically assigned P1 clones."
    Sato S., Kotani H., Nakamura Y., Kaneko T., Asamizu E., Fukami M., Miyajima N., Tabata S.
    DNA Res. 4:215-230(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: cv. Columbia.
  3. The Arabidopsis Information Resource (TAIR)
    Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: GENOME REANNOTATION.
    Strain: cv. Columbia.
  4. "Empirical analysis of transcriptional activity in the Arabidopsis genome."
    Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.
    , Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J., Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y., Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P., Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F., Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M., Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J., Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T., Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y., Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.
    Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: cv. Columbia.
  5. "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs."
    Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.
    , Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J., Hayashizaki Y., Shinozaki K.
    Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: cv. Columbia.
  6. "Whole genome sequence comparisons and 'full-length' cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation."
    Castelli V., Aury J.-M., Jaillon O., Wincker P., Clepet C., Menard M., Cruaud C., Quetier F., Scarpelli C., Schaechter V., Temple G., Caboche M., Weissenbach J., Salanoubat M.
    Genome Res. 14:406-413(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM2).
    Strain: cv. Columbia.
  7. "Immunological characterization and chloroplast localization of the tryptophan biosynthetic enzymes of the flowering plant Arabidopsis thaliana."
    Zhao J., Last R.L.
    J. Biol. Chem. 270:6081-6087(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  8. "Differential expression of triplicate phosphoribosylanthranilate isomerase isogenes in the tryptophan biosynthetic pathway of Arabidopsis thaliana (L.) Heynh."
    He Y., Li J.
    Planta 212:641-647(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, INDUCTION.

Entry informationi

Entry nameiPAI2_ARATH
AccessioniPrimary (citable) accession number: Q42527
Secondary accession number(s): F4K0R4, Q9FFF7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2012
Last sequence update: November 1, 1996
Last modified: January 7, 2015
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.