Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic

Gene

PAI2

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Catalytic activityi

N-(5-phospho-beta-D-ribosyl)anthranilate = 1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate.

Pathwayi: L-tryptophan biosynthesis

This protein is involved in step 3 of the subpathway that synthesizes L-tryptophan from chorismate.
Proteins known to be involved in the 5 steps of the subpathway in this organism are:
  1. Anthranilate synthase beta subunit 2, chloroplastic (ASB2), Anthranilate synthase beta subunit 1, chloroplastic (ASB1), Anthranilate synthase alpha subunit 1, chloroplastic (ASA1), Anthranilate synthase alpha subunit 2, chloroplastic (ASA2)
  2. Anthranilate phosphoribosyltransferase, chloroplastic (PAT1)
  3. N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic (PAI2), N-(5'-phosphoribosyl)anthranilate isomerase 3, chloroplastic (PAI3), N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic (PAI1)
  4. Indole-3-glycerol phosphate synthase, chloroplastic (IGPS)
  5. Tryptophan synthase alpha chain (TRPA1), Tryptophan synthase alpha chain, chloroplastic (TSA1), Tryptophan synthase (AXX17_At5g53930), Tryptophan synthase (At5g54810), Tryptophan synthase (At5g28237), Tryptophan synthase (AXX17_At5g28490), Tryptophan synthase (AXX17_At4g31220), Tryptophan synthase, Tryptophan synthase beta chain 1, chloroplastic (TSB1), Tryptophan synthase (At4g27070), Tryptophan synthase (At5g28237), Tryptophan synthase beta chain 2, chloroplastic (TSB2), Tryptophan synthase (AXX17_At4g31220)
This subpathway is part of the pathway L-tryptophan biosynthesis, which is itself part of Amino-acid biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes L-tryptophan from chorismate, the pathway L-tryptophan biosynthesis and in Amino-acid biosynthesis.

GO - Molecular functioni

  • phosphoribosylanthranilate isomerase activity Source: TAIR

GO - Biological processi

  • tryptophan biosynthetic process Source: TAIR

Keywordsi

Molecular functionIsomerase
Biological processAmino-acid biosynthesis, Aromatic amino acid biosynthesis, Tryptophan biosynthesis

Enzyme and pathway databases

BioCyciARA:AT5G05590-MONOMER
UniPathwayiUPA00035; UER00042

Names & Taxonomyi

Protein namesi
Recommended name:
N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic (EC:5.3.1.24)
Gene namesi
Name:PAI2
Ordered Locus Names:At5g05590
ORF Names:MOP10.13
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 5

Organism-specific databases

AraportiAT5G05590
TAIRilocus:2169687 AT5G05590

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chloroplast, Plastid

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 32ChloroplastSequence analysisAdd BLAST32
ChainiPRO_000041745433 – 275N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplasticAdd BLAST243

Proteomic databases

PaxDbiQ42527
PRIDEiQ42527

Expressioni

Tissue specificityi

Expressed in roots and shoots.1 Publication

Inductioni

By silver nitrate and UV irradiation.1 Publication

Gene expression databases

ExpressionAtlasiQ42527 baseline and differential
GenevisibleiQ42527 AT

Interactioni

Protein-protein interaction databases

STRINGi3702.AT5G05590.1

Structurei

3D structure databases

ProteinModelPortaliQ42527
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the TrpF family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG4202 Eukaryota
COG0135 LUCA
HOGENOMiHOG000161598
KOiK01817
OMAiCEIMEIC
OrthoDBiEOG09360HV1
PhylomeDBiQ42527

Family and domain databases

CDDicd00405 PRAI, 1 hit
Gene3Di3.20.20.70, 1 hit
HAMAPiMF_00135 PRAI, 1 hit
InterProiView protein in InterPro
IPR013785 Aldolase_TIM
IPR001240 PRAI
IPR011060 RibuloseP-bd_barrel
PfamiView protein in Pfam
PF00697 PRAI, 1 hit
SUPFAMiSSF51366 SSF51366, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q42527-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTGISTDLH VHFGALNFSK TYKSGLSNRT VSFSRVGYAQ NRKLSCSVSN
60 70 80 90 100
TENVAPKDDE RGKDRPLVKM CGITSARDAA MAVEAGADFI GMIIWPHSKR
110 120 130 140 150
SISLSVAKDI SKVAREGGAK PVGVFVEDDD NTILRAADSS DLELVQLHGN
160 170 180 190 200
GSRAAFSRLV RKRRVIYVLN ANQDGKLLNE VPEEDCHLAD WILVDSATGG
210 220 230 240 250
SGHGFNWAQF KLPSVRSRNG WLLAGGINPT NVSEALSILQ PDGIDVSSGI
260 270
CGTDGIQKDK SKISSFITAV RSVHY
Length:275
Mass (Da):29,619
Last modified:November 1, 1996 - v1
Checksum:iFF55DC899925F2C7
GO
Isoform 2 (identifier: Q42527-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-146: Q → QVLYILIDFDFALTKVIFSTLLTVDSYGFLQ
     201-225: SGHGFNWAQFKLPSVRSRNGWLLAG → RYQEQLFNFFRIVMYSLEEKFKQSL
     226-275: Missing.

Note: No experimental confirmation available.
Show »
Length:255
Mass (Da):28,314
Checksum:iFF8F1A55B2944244
GO

Sequence cautioni

The sequence BAB11548 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BX829410 differs from that shown. Sequencing errors.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_043742146Q → QVLYILIDFDFALTKVIFST LLTVDSYGFLQ in isoform 2. Curated1
Alternative sequenceiVSP_043743201 – 225SGHGF…WLLAG → RYQEQLFNFFRIVMYSLEEK FKQSL in isoform 2. CuratedAdd BLAST25
Alternative sequenceiVSP_043744226 – 275Missing in isoform 2. CuratedAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U18968 Genomic DNA Translation: AAC49003.1
AB005241 Genomic DNA Translation: BAB11548.1 Sequence problems.
CP002688 Genomic DNA Translation: AED90894.1
CP002688 Genomic DNA Translation: AED90895.1
BT003070 mRNA Translation: AAO23635.1
AK227265 mRNA Translation: BAE99293.1
BX829410 mRNA No translation available.
RefSeqiNP_196178.2, NM_120641.5 [Q42527-1]
NP_974734.1, NM_203005.2 [Q42527-2]
UniGeneiAt.273
At.48165
At.48988

Genome annotation databases

EnsemblPlantsiAT5G05590.1; AT5G05590.1; AT5G05590 [Q42527-1]
AT5G05590.2; AT5G05590.2; AT5G05590 [Q42527-2]
GeneIDi830442
GrameneiAT5G05590.1; AT5G05590.1; AT5G05590 [Q42527-1]
AT5G05590.2; AT5G05590.2; AT5G05590 [Q42527-2]
KEGGiath:AT5G05590

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPAI2_ARATH
AccessioniPrimary (citable) accession number: Q42527
Secondary accession number(s): F4K0R4, Q9FFF7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2012
Last sequence update: November 1, 1996
Last modified: April 25, 2018
This is version 131 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health