Q42527 (PAI2_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic EC=5.3.1.24 | ||||||
| Gene names |
| ||||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) [Reference proteome] | ||||||
| Taxonomic identifier | 3702 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis![]() |
Protein attributes
| Sequence length | 275 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | N-(5-phospho-beta-D-ribosyl)anthranilate = 1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate. |
| Pathway | Amino-acid biosynthesis; L-tryptophan biosynthesis; L-tryptophan from chorismate: step 3/5. |
| Subcellular location | |
| Tissue specificity | Expressed in roots and shoots. Ref.8 |
| Induction | By silver nitrate and UV irradiation. Ref.8 |
| Sequence similarities | Belongs to the TrpF family. |
| Sequence caution | The sequence BAB11548.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence BX829410 differs from that shown. Reason: Sequencing errors. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Amino-acid biosynthesis Aromatic amino acid biosynthesis Tryptophan biosynthesis |
| Cellular component | Chloroplast Plastid |
| Coding sequence diversity | Alternative splicing |
| Domain | Transit peptide |
| Molecular function | Isomerase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | tryptophan biosynthetic process Inferred from mutant phenotype Ref.1. Source: TAIR |
| Cellular_component | chloroplast Inferred from direct assay Ref.7. Source: UniProtKB |
| Molecular_function | phosphoribosylanthranilate isomerase activity Inferred from sequence or structural similarity Ref.1. Source: TAIR |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q42527-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q42527-2) The sequence of this isoform differs from the canonical sequence as follows: 146-146: Q → QVLYILIDFDFALTKVIFSTLLTVDSYGFLQ 201-225: SGHGFNWAQFKLPSVRSRNGWLLAG → RYQEQLFNFFRIVMYSLEEKFKQSL 226-275: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 32 | 32 | Chloroplast Potential | ||||||
| Chain | 33 – 275 | 243 | N-(5'-phosphoribosyl)anthranilate isomerase 2, chloroplastic | PRO_0000417454 | |||||
Natural variations | |||||||||
| Alternative sequence | 146 | 1 | Q → QVLYILIDFDFALTKVIFST LLTVDSYGFLQ in isoform 2. | VSP_043742 | |||||
| Alternative sequence | 201 – 225 | 25 | SGHGF…WLLAG → RYQEQLFNFFRIVMYSLEEK FKQSL in isoform 2. | VSP_043743 | |||||
| Alternative sequence | 226 – 275 | 50 | Missing in isoform 2. | VSP_043744 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Arabidopsis phosphoribosylanthranilate isomerase: molecular genetic analysis of triplicate tryptophan pathway genes." Li J., Zhao J., Rose A.B., Schmidt R., Last R.L. Plant Cell 7:447-461(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: cv. Columbia. |
| [2] | "Structural analysis of Arabidopsis thaliana chromosome 5. I. Sequence features of the 1.6 Mb regions covered by twenty physically assigned P1 clones." Sato S., Kotani H., Nakamura Y., Kaneko T., Asamizu E., Fukami M., Miyajima N., Tabata S. DNA Res. 4:215-230(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [3] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [4] | "Empirical analysis of transcriptional activity in the Arabidopsis genome." Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. Ecker J.R.Science 302:842-846(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: cv. Columbia. |
| [5] | "Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs." Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A., Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y., Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K. Shinozaki K.Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: cv. Columbia. |
| [6] | "Whole genome sequence comparisons and 'full-length' cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation." Castelli V., Aury J.-M., Jaillon O., Wincker P., Clepet C., Menard M., Cruaud C., Quetier F., Scarpelli C., Schaechter V., Temple G., Caboche M., Weissenbach J., Salanoubat M. Genome Res. 14:406-413(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM2). Strain: cv. Columbia. |
| [7] | "Immunological characterization and chloroplast localization of the tryptophan biosynthetic enzymes of the flowering plant Arabidopsis thaliana." Zhao J., Last R.L. J. Biol. Chem. 270:6081-6087(1995) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [8] | "Differential expression of triplicate phosphoribosylanthranilate isomerase isogenes in the tryptophan biosynthetic pathway of Arabidopsis thaliana (L.) Heynh." He Y., Li J. Planta 212:641-647(2001) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, INDUCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U18968 Genomic DNA. Translation: AAC49003.1. AB005241 Genomic DNA. Translation: BAB11548.1. Sequence problems. CP002688 Genomic DNA. Translation: AED90894.1. CP002688 Genomic DNA. Translation: AED90895.1. BT003070 mRNA. Translation: AAO23635.1. AK227265 mRNA. Translation: BAE99293.1. BX829410 mRNA. No translation available. |
| IPI | IPI00539464. |
| RefSeq | NP_196178.2. NM_120641.4. NP_974734.1. NM_203005.2. |
| UniGene | At.273. At.48165. At.48988. |
3D structure databases | |
| ProteinModelPortal | Q42527. |
| SMR | Q42527. Positions 68-273. |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q42527. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | AT5G05590.1; AT5G05590.1; AT5G05590. |
| GeneID | 830442. |
| KEGG | ath:AT5G05590. |
Organism-specific databases | |
| TAIR | At5g05590. |
Phylogenomic databases | |
| HOGENOM | HOG000161598. |
| InParanoid | Q42527. |
| KO | K01817. |
| OMA | ISALHCE. |
| PhylomeDB | Q42527. |
| ProtClustDB | PLN02363. |
Enzyme and pathway databases | |
| UniPathway | UPA00035; UER00042. |
Gene expression databases | |
| ArrayExpress | Q42527. |
| Genevestigator | Q42527. |
Family and domain databases | |
| Gene3D | 3.20.20.70. 1 hit. |
| InterPro | IPR013785. Aldolase_TIM. IPR001240. PRAI_dom. IPR011060. RibuloseP-bd_barrel. [Graphical view] |
| Pfam | PF00697. PRAI. 1 hit. [Graphical view] |
| SUPFAM | SSF51366. RibP_bind_barrel. 1 hit. |
| ProtoNet | Search... |
Entry information
| Entry name | PAI2_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q42527 Secondary accession number(s): F4K0R4, Q9FFF7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
