Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

U1 small nuclear ribonucleoprotein 70 kDa

Gene

RNU1

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.

GO - Molecular functioni

GO - Biological processi

  • mRNA splicing, via spliceosome Source: TAIR

Keywordsi

Molecular functionRibonucleoprotein, RNA-binding
Biological processmRNA processing, mRNA splicing

Names & Taxonomyi

Protein namesi
Recommended name:
U1 small nuclear ribonucleoprotein 70 kDa
Short name:
U1 snRNP 70 kDa
Short name:
U1-70K
Short name:
snRNP70
Gene namesi
Name:RNU1
Ordered Locus Names:At3g50670
ORF Names:T3A5.50
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 3

Organism-specific databases

AraportiAT3G50670
TAIRilocus:2101714 AT3G50670

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus, Spliceosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000818851 – 427U1 small nuclear ribonucleoprotein 70 kDaAdd BLAST427

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei282PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated. The association and dissociation with SR45 is not affected by the phosphorylation status (PubMed:18414657).1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ42404
PRIDEiQ42404

PTM databases

iPTMnetiQ42404

Expressioni

Tissue specificityi

Ubiquitous.

Gene expression databases

ExpressionAtlasiQ42404 baseline and differential
GenevisibleiQ42404 AT

Interactioni

Subunit structurei

Component of the spliceosome. Interacts with CYP63, U2AF35A, U2AF35B, SRZ21, RSZ22, SR34, SR45, SR45A and SCL33.6 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi9548, 12 interactors
IntActiQ42404, 9 interactors
MINTiQ42404
STRINGi3702.AT3G50670.1

Structurei

3D structure databases

ProteinModelPortaliQ42404
SMRiQ42404
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini138 – 216RRMPROSITE-ProRule annotationAdd BLAST79

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi256 – 280Arg/Glu-rich (mixed charge)Add BLAST25
Compositional biasi287 – 427Arg/Asp/Glu-rich (mixed charge)Add BLAST141

Phylogenomic databases

eggNOGiKOG0113 Eukaryota
COG0724 LUCA
HOGENOMiHOG000236289
InParanoidiQ42404
KOiK11093
OMAiNDVNIKH
OrthoDBiEOG09360JBB
PhylomeDBiQ42404

Family and domain databases

CDDicd12236 RRM_snRNP70, 1 hit
Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
IPR034143 snRNP70_RRM
IPR022023 U1snRNP70_N
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
PF12220 U1snRNP70_N, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: Q42404-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGDSGDPFLR NPNAAVQARA KVQNRANVLQ LKLMGQSHPT GLTNNLLKLF
60 70 80 90 100
EPRPPLEYKP PPEKRKCPPY TGMAQFVSNF AEPGDPEYAP PKPEVELPSQ
110 120 130 140 150
KRERIHKLRL EKGVEKAAED LKKYDPNNDP NATGDPYKTL FVSRLNYESS
160 170 180 190 200
ESKIKREFES YGPIKRVHLV TDQLTNKPKG YAFIEYMHTR DMKAAYKQAD
210 220 230 240 250
GQKIDGRRVL VDVERGRTVP NWRPRRLGGG LGTSRVGGGE EIVGEQQPQG
260 270 280 290 300
RTSQSEEPSR PREEREKSRE KGKERERSRE LSHEQPRERS RDRPREDKHH
310 320 330 340 350
RDRDQGGRDR DRDSRRDRDR TRDRGDRDRR DRDRGRDRTS RDHDRDRSRK
360 370 380 390 400
KERDYEGGEY EHEGGGRSRE RDAEYRGEPE ETRGYYEDDQ GDTDRYSHRY
410 420
DKMEEDDFRY EREYKRSKRS ESREYVR
Length:427
Mass (Da):50,388
Last modified:November 1, 1996 - v1
Checksum:i2B35E824EF35A341
GO
Isoform Short (identifier: Q42404-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-204: HLVTDQLTNKPKGYAFIEYMHTRDMKAAYKQADGQKI → GYSEHSLAGSVRICVMASLSRALCSICFILSTKVFQG
     205-427: Missing.

Show »
Length:204
Mass (Da):22,849
Checksum:i129A38D92AF9A9A1
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005853168 – 204HLVTD…DGQKI → GYSEHSLAGSVRICVMASLS RALCSICFILSTKVFQG in isoform Short. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_005854205 – 427Missing in isoform Short. 1 PublicationAdd BLAST223

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M93439 mRNA Translation: AAD12773.1
U52909 Genomic DNA Translation: AAD12774.1
U52909 Genomic DNA Translation: AAD12775.1
U52910 mRNA Translation: AAD12776.1
AL132979 Genomic DNA Translation: CAB62436.1
CP002686 Genomic DNA Translation: AEE78692.1
CP002686 Genomic DNA Translation: AEE78693.1
AY039874 mRNA Translation: AAK63978.1
AY094003 mRNA Translation: AAM16264.1
PIRiS71367
RefSeqiNP_190636.1, NM_114927.4 [Q42404-1]
NP_850676.1, NM_180345.1 [Q42404-2]
UniGeneiAt.25571

Genome annotation databases

EnsemblPlantsiAT3G50670.1; AT3G50670.1; AT3G50670 [Q42404-1]
AT3G50670.2; AT3G50670.2; AT3G50670 [Q42404-2]
GeneIDi824230
GrameneiAT3G50670.1; AT3G50670.1; AT3G50670 [Q42404-1]
AT3G50670.2; AT3G50670.2; AT3G50670 [Q42404-2]
KEGGiath:AT3G50670

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRU17_ARATH
AccessioniPrimary (citable) accession number: Q42404
Secondary accession number(s): Q42378
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: November 1, 1996
Last modified: May 23, 2018
This is version 150 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health