Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable mitochondrial-processing peptidase subunit beta, mitochondrial

Gene

At3g02090

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cleaves presequences (transit peptides) from mitochondrial protein precursors.By similarity

Catalytic activityi

Release of N-terminal transit peptides from precursor proteins imported into the mitochondrion, typically with Arg in position P2.

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi141ZincPROSITE-ProRule annotation1
Active sitei144Proton acceptorPROSITE-ProRule annotation1
Metal bindingi145ZincPROSITE-ProRule annotation1
Active sitei214Curated1
Metal bindingi221ZincCurated1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Oxidoreductase, Protease

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciARA:AT3G02090-MONOMER.
MetaCyc:AT3G02090-MONOMER.

Protein family/group databases

MEROPSiM16.003.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable mitochondrial-processing peptidase subunit beta, mitochondrial (EC:3.4.24.64)
Alternative name(s):
Beta-MPP
Gene namesi
Ordered Locus Names:At3g02090Imported
ORF Names:F1C9.12Imported
OrganismiArabidopsis thaliana (Mouse-ear cress)
Taxonomic identifieri3702 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
Proteomesi
  • UP000006548 Componenti: Chromosome 3

Organism-specific databases

TAIRiAT3G02090.

Subcellular locationi

GO - Cellular componenti

  • cell wall Source: TAIR
  • chloroplast Source: TAIR
  • membrane Source: TAIR
  • mitochondrial inner membrane Source: TAIR
  • mitochondrial intermembrane space Source: TAIR
  • mitochondrial matrix Source: TAIR
  • mitochondrial outer membrane Source: TAIR
  • mitochondrial respiratory chain complex III Source: TAIR
  • mitochondrion Source: TAIR
  • nucleolus Source: TAIR
  • vacuolar membrane Source: TAIR
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 25MitochondrionSequence analysisAdd BLAST25
ChainiPRO_000004585226 – 531Probable mitochondrial-processing peptidase subunit beta, mitochondrialAdd BLAST506

Proteomic databases

PaxDbiQ42290.
PRIDEiQ42290.

Expressioni

Gene expression databases

ExpressionAtlasiQ42290. baseline and differential.
GenevisibleiQ42290. AT.

Interactioni

Subunit structurei

Heterodimer of alpha and beta subunits.By similarity

Protein-protein interaction databases

BioGridi6417. 5 interactors.
IntActiQ42290. 4 interactors.
MINTiMINT-4330335.
STRINGi3702.AT3G02090.2.

Structurei

3D structure databases

ProteinModelPortaliQ42290.
SMRiQ42290.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi25 – 30Poly-Ser6
Compositional biasi46 – 49Poly-Pro4

Sequence similaritiesi

Belongs to the peptidase M16 family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG0960. Eukaryota.
COG0612. LUCA.
HOGENOMiHOG000242450.
InParanoidiQ42290.
KOiK17732.
OMAiCYSIFAQ.
PhylomeDBiQ42290.

Family and domain databases

Gene3Di3.30.830.10. 2 hits.
InterProiIPR011249. Metalloenz_LuxS/M16.
IPR011237. Pept_M16_dom.
IPR011765. Pept_M16_N.
IPR001431. Pept_M16_Zn_BS.
IPR007863. Peptidase_M16_C.
[Graphical view]
PfamiPF00675. Peptidase_M16. 1 hit.
PF05193. Peptidase_M16_C. 1 hit.
[Graphical view]
SUPFAMiSSF63411. SSF63411. 2 hits.
PROSITEiPS00143. INSULINASE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q42290-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAMKNLLSLA RRSQRRLFLT QATRSSSSFS AIDSVPASAS PTALSPPPPH
60 70 80 90 100
LMPYDHAAEI IKNKIKKLEN PDKRFLKYAS PHPILASHNH ILSAPETRVT
110 120 130 140 150
TLPNGLRVAT ESNLSAKTAT VGVWIDAGSR FESDETNGTA HFLEHMIFKG
160 170 180 190 200
TDRRTVRALE EEIEDIGGHL NAYTSREQTT YYAKVLDSNV NQALDVLADI
210 220 230 240 250
LQNSKFEEQR INRERDVILR EMQEVEGQTD EVVLDHLHAT AFQYTPLGRT
260 270 280 290 300
ILGPAQNVKS ITREDLQNYI KTHYTASRMV IAAAGAVKHE EVVEQVKKLF
310 320 330 340 350
TKLSSDPTTT SQLVANEPAS FTGSEVRMID DDLPLAQFAV AFEGASWTDP
360 370 380 390 400
DSVALMVMQT MLGSWNKNVG GGKHVGSDLT QRVAINEIAE SIMAFNTNYK
410 420 430 440 450
DTGLFGVYAV AKADCLDDLS YAIMYEVTKL AYRVSDADVT RARNQLKSSL
460 470 480 490 500
LLHMDGTSPI AEDIGRQLLT YGRRIPTAEL FARIDAVDAS TVKRVANKYI
510 520 530
YDKDIAISAI GPIQDLPDYN KFRRRTYWNR Y
Length:531
Mass (Da):59,160
Last modified:January 24, 2006 - v2
Checksum:i08A3953AD192E6B5
GO
Isoform 2 (identifier: Q42290-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     504-531: DIAISAIGPIQDLPDYNKFRRRTYWNRY → VRHCNLSYWSNPRFARLQQIQTQNLLEPVLRL

Note: Derived from EST data. May be due to a competing donor splice site. No experimental confirmation available.
Show »
Length:535
Mass (Da):59,612
Checksum:iE5D83B408D218D8A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti132E → G in BAE98412 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_018097504 – 531DIAIS…YWNRY → VRHCNLSYWSNPRFARLQQI QTQNLLEPVLRL in isoform 2. CuratedAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC011664 Genomic DNA. Translation: AAF14827.1.
CP002686 Genomic DNA. Translation: AEE73761.1.
CP002686 Genomic DNA. Translation: AEE73762.1.
AY126990 mRNA. Translation: AAM83217.1.
BT000830 mRNA. Translation: AAN33205.1.
BT000662 mRNA. Translation: AAN31809.1.
BT001915 mRNA. Translation: AAN71914.1.
AK226251 mRNA. Translation: BAE98412.1.
Z35354 mRNA. Translation: CAA84561.1.
RefSeqiNP_186858.1. NM_111075.3. [Q42290-1]
NP_850500.1. NM_180169.1. [Q42290-2]
UniGeneiAt.23364.
At.69050.
At.74786.

Genome annotation databases

EnsemblPlantsiAT3G02090.1; AT3G02090.1; AT3G02090. [Q42290-1]
GeneIDi821084.
GrameneiAT3G02090.1; AT3G02090.1; AT3G02090.
KEGGiath:AT3G02090.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC011664 Genomic DNA. Translation: AAF14827.1.
CP002686 Genomic DNA. Translation: AEE73761.1.
CP002686 Genomic DNA. Translation: AEE73762.1.
AY126990 mRNA. Translation: AAM83217.1.
BT000830 mRNA. Translation: AAN33205.1.
BT000662 mRNA. Translation: AAN31809.1.
BT001915 mRNA. Translation: AAN71914.1.
AK226251 mRNA. Translation: BAE98412.1.
Z35354 mRNA. Translation: CAA84561.1.
RefSeqiNP_186858.1. NM_111075.3. [Q42290-1]
NP_850500.1. NM_180169.1. [Q42290-2]
UniGeneiAt.23364.
At.69050.
At.74786.

3D structure databases

ProteinModelPortaliQ42290.
SMRiQ42290.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi6417. 5 interactors.
IntActiQ42290. 4 interactors.
MINTiMINT-4330335.
STRINGi3702.AT3G02090.2.

Protein family/group databases

MEROPSiM16.003.

Proteomic databases

PaxDbiQ42290.
PRIDEiQ42290.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblPlantsiAT3G02090.1; AT3G02090.1; AT3G02090. [Q42290-1]
GeneIDi821084.
GrameneiAT3G02090.1; AT3G02090.1; AT3G02090.
KEGGiath:AT3G02090.

Organism-specific databases

TAIRiAT3G02090.

Phylogenomic databases

eggNOGiKOG0960. Eukaryota.
COG0612. LUCA.
HOGENOMiHOG000242450.
InParanoidiQ42290.
KOiK17732.
OMAiCYSIFAQ.
PhylomeDBiQ42290.

Enzyme and pathway databases

BioCyciARA:AT3G02090-MONOMER.
MetaCyc:AT3G02090-MONOMER.

Miscellaneous databases

PROiQ42290.

Gene expression databases

ExpressionAtlasiQ42290. baseline and differential.
GenevisibleiQ42290. AT.

Family and domain databases

Gene3Di3.30.830.10. 2 hits.
InterProiIPR011249. Metalloenz_LuxS/M16.
IPR011237. Pept_M16_dom.
IPR011765. Pept_M16_N.
IPR001431. Pept_M16_Zn_BS.
IPR007863. Peptidase_M16_C.
[Graphical view]
PfamiPF00675. Peptidase_M16. 1 hit.
PF05193. Peptidase_M16_C. 1 hit.
[Graphical view]
SUPFAMiSSF63411. SSF63411. 2 hits.
PROSITEiPS00143. INSULINASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMPPB_ARATH
AccessioniPrimary (citable) accession number: Q42290
Secondary accession number(s): Q0WWT6, Q9SGA7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 24, 2006
Last sequence update: January 24, 2006
Last modified: November 30, 2016
This is version 123 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.