Q42290 (MPPB_ARATH) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable mitochondrial-processing peptidase subunit beta EC=3.4.24.64 Alternative name(s): Beta-MPP | ||||
| Gene names |
| ||||
| Organism | Arabidopsis thaliana (Mouse-ear cress) | ||||
| Taxonomic identifier | 3702 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Viridiplantae › Streptophyta › Embryophyta › Tracheophyta › Spermatophyta › Magnoliophyta › eudicotyledons › core eudicotyledons › rosids › malvids › Brassicales › Brassicaceae › Camelineae › Arabidopsis |
Protein attributes
| Sequence length | 531 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Cleaves presequences (transit peptides) from mitochondrial protein precursors By similarity. |
| Catalytic activity | Release of N-terminal transit peptides from precursor proteins imported into the mitochondrion, typically with Arg in position P2. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subunit structure | Heterodimer of alpha and beta subunits By similarity. |
| Subcellular location | |
| Sequence similarities | Belongs to the peptidase M16 family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q42290-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q42290-2) The sequence of this isoform differs from the canonical sequence as follows: 504-531: DIAISAIGPIQDLPDYNKFRRRTYWNRY → VRHCNLSYWSNPRFARLQQIQTQNLLEPVLRL | ||||||
| Note: Derived from EST data. May be due to a competing donor splice site. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 25 | 25 | Mitochondrion Potential | ||||||
| Chain | 26 – 531 | 506 | Probable mitochondrial-processing peptidase subunit beta | PRO_0000045852 | |||||
Regions | |||||||||
| Compositional bias | 25 – 30 | 6 | Poly-Ser | ||||||
| Compositional bias | 46 – 49 | 4 | Poly-Pro | ||||||
Sites | |||||||||
| Active site | 144 | 1 | Proton acceptor By similarity | ||||||
| Active site | 214 | 1 | By similarity | ||||||
| Metal binding | 141 | 1 | Zinc By similarity | ||||||
| Metal binding | 145 | 1 | Zinc By similarity | ||||||
| Metal binding | 221 | 1 | Zinc By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 504 – 531 | 28 | DIAIS…YWNRY → VRHCNLSYWSNPRFARLQQI QTQNLLEPVLRL in isoform 2. | VSP_018097 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Sequence and analysis of chromosome 3 of the plant Arabidopsis thaliana." Salanoubat M., Lemcke K., Rieger M., Ansorge W., Unseld M., Fartmann B., Valle G., Bloecker H., Perez-Alonso M., Obermaier B., Delseny M., Boutry M., Grivell L.A., Mache R., Puigdomenech P., De Simone V., Choisne N., Artiguenave F. Tabata S.Nature 408:820-822(2000) [PubMed: 11130713] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: cv. Columbia. |
| [2] | The Arabidopsis Information Resource (TAIR) Submitted (APR-2011) to the EMBL/GenBank/DDBJ databases Cited for: GENOME REANNOTATION. Strain: cv. Columbia. |
| [3] | "Empirical analysis of transcriptional activity in the Arabidopsis genome." Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J., Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F., Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G. Ecker J.R.Science 302:842-846(2003) [PubMed: 14593172] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: cv. Columbia. |
| [4] | "Further progress towards a catalogue of all Arabidopsis genes: analysis of a set of 5000 non-redundant ESTs." Cooke R., Raynal M., Laudie M., Grellet F., Delseny M., Morris P.-C., Guerrier D., Giraudat J., Quigley F., Clabault G., Li Y.-F., Mache R., Krivitzky M., Gy I.J.-J., Kreis M., Lecharny A., Parmentier Y., Marbach J. Hoefte H.Plant J. 9:101-124(1996) [PubMed: 8580968] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 321-421. Strain: cv. Columbia. Tissue: Leaf. |
| [5] | "Experimental analysis of the Arabidopsis mitochondrial proteome highlights signaling and regulatory components, provides assessment of targeting prediction programs, and indicates plant-specific mitochondrial proteins." Heazlewood J.L., Tonti-Filippini J.S., Gout A.M., Day D.A., Whelan J., Millar A.H. Plant Cell 16:241-256(2004) [PubMed: 14671022] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS]. Strain: cv. Landsberg erecta. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC011664 Genomic DNA. Translation: AAF14827.1. CP002686 Genomic DNA. Translation: AEE73761.1. CP002686 Genomic DNA. Translation: AEE73762.1. AY126990 mRNA. Translation: AAM83217.1. BT000830 mRNA. Translation: AAN33205.1. BT000662 mRNA. Translation: AAN31809.1. BT001915 mRNA. Translation: AAN71914.1. Z35354 mRNA. Translation: CAA84561.1. |
| IPI | IPI00530627. IPI00539775. |
| RefSeq | NP_186858.1. NM_111075.2. NP_850500.1. NM_180169.1. |
| UniGene | At.23364. At.69050. At.74786. |
3D structure databases | |
| ProteinModelPortal | Q42290. |
| SMR | Q42290. Positions 91-531. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q42290. 2 interactions. |
| MINT | MINT-4330335. |
| STRING | Q42290. |
Proteomic databases | |
| PRIDE | Q42290. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| EnsemblPlants | AT3G02090.1; AT3G02090.1; AT3G02090. |
| GeneID | 821084. |
| GenomeReviews | Gene locus AT3G02090 in contig BA000014_GR. |
| KEGG | ath:AT3G02090. |
| NMPDR | fig|3702.1.peg.12145. |
Organism-specific databases | |
| GeneFarm | 2127. 202. |
| TAIR | At3g02090. |
Phylogenomic databases | |
| HOGENOM | HBG476859. |
| InParanoid | Q42290. |
| OMA | IPLMVAN. |
| PhylomeDB | Q42290. |
| ProtClustDB | CLSN2685188. |
Gene expression databases | |
| Genevestigator | Q42290. |
| GermOnline | AT3G02090. Arabidopsis thaliana. |
Family and domain databases | |
| InterPro | IPR011249. Metalloenz_metal-bd. IPR011237. Pept_M16_core. IPR011765. Pept_M16_N. IPR001431. Pept_M16_Zn_BS. IPR007863. Peptidase_M16_C. [Graphical view] |
| Gene3D | G3DSA:3.30.830.10. Pept_M16_core. 2 hits. |
| KO | K01412. |
| Pfam | PF00675. Peptidase_M16. 1 hit. PF05193. Peptidase_M16_C. 1 hit. [Graphical view] |
| SUPFAM | SSF63411. Metalloenz_metal-bd. 2 hits. |
| PROSITE | PS00143. INSULINASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | MPPB_ARATH | ||||||||
| Accession | Primary (citable) accession number: Q42290 Secondary accession number(s): Q9SGA7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Plant Protein Annotation Program | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Arabidopsis thaliana Arabidopsis thaliana: entries and gene names |
| SIMILARITY comments Index of protein domains and families |

Clusters with