Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

TMV resistance protein N

Gene

N

Organism
Nicotiana glutinosa (Tobacco)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi216 – 223ATPSequence analysis8

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Hypersensitive response, Plant defense

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
TMV resistance protein N
Gene namesi
Name:N
OrganismiNicotiana glutinosa (Tobacco)
Taxonomic identifieri35889 [NCBI]
Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliophytaeudicotyledonsGunneridaePentapetalaeasteridslamiidsSolanalesSolanaceaeNicotianoideaeNicotianeaeNicotiana

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi12Y → S or F: Partial loss of resistance. 1
Mutagenesisi46D → H: Loss of resistance. 1 Publication1
Mutagenesisi46D → Y: No effect. 1 Publication1
Mutagenesisi63I → M: Loss of resistance. 1 Publication1
Mutagenesisi63I → V: No effect. 1 Publication1
Mutagenesisi66S → A: No effect. 1 Publication1
Mutagenesisi67Q → E or K: Partial loss of resistance. 1 Publication1
Mutagenesisi82W → S or A: Partial loss of resistance. 1 Publication1
Mutagenesisi138I → V or F: Partial loss of resistance. 1 Publication1
Mutagenesisi141W → S or A: Partial loss of resistance. 1 Publication1
Mutagenesisi142R → K or S: Partial loss of resistance. 1 Publication1
Mutagenesisi216G → A, E, V or R: Loss of resistance. 1 Publication1
Mutagenesisi218G → P: No effect. 1 Publication1
Mutagenesisi218G → R: Loss of resistance. 1 Publication1
Mutagenesisi218G → V or S: Partial loss of resistance. 1 Publication1
Mutagenesisi219G → D: Loss of resistance. 1 Publication1
Mutagenesisi219G → V: Partial loss of resistance. 1 Publication1
Mutagenesisi222K → E or N: Loss of resistance. 1 Publication1
Mutagenesisi223T → A or N: Loss of resistance. 1 Publication1
Mutagenesisi223T → S: Partial loss of resistance. 1 Publication1
Mutagenesisi301D → H, N or Y: Loss of resistance. 1 Publication1
Mutagenesisi325R → Y or G: Loss of resistance. 1 Publication1
Mutagenesisi619P → A or T: Partial loss of resistance. 1 Publication1
Mutagenesisi619P → S: Loss of resistance. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002127811 – 1144TMV resistance protein NAdd BLAST1144

Expressioni

Developmental stagei

Isoform 1 is more prevalent before and for 3 hours after tobacco mosaic virus (TMV) infection, while isoform 2 is more prevalent 4 to 8 hours after TMV infection.1 Publication

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
NRIP1B2C7Y63EBI-1804401,EBI-1809509From a different organism.

Protein-protein interaction databases

IntActiQ40392. 1 interactor.

Structurei

3D structure databases

ProteinModelPortaliQ40392.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini10 – 151TIRPROSITE-ProRule annotationAdd BLAST142
Domaini172 – 447NB-ARCAdd BLAST276
Repeati597 – 618LRR 1Add BLAST22
Repeati620 – 642LRR 2Add BLAST23
Repeati643 – 665LRR 3Add BLAST23
Repeati834 – 854LRR 4Add BLAST21
Repeati859 – 880LRR 5Add BLAST22
Repeati882 – 904LRR 6Add BLAST23

Sequence similaritiesi

Belongs to the disease resistance NB-LRR family.Curated
Contains 6 LRR (leucine-rich) repeats.Curated
Contains 1 NB-ARC domain.Curated
Contains 1 TIR domain.PROSITE-ProRule annotation

Keywords - Domaini

Leucine-rich repeat, Repeat

Family and domain databases

Gene3Di3.40.50.10140. 1 hit.
3.40.50.300. 1 hit.
3.80.10.10. 2 hits.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR002182. NB-ARC.
IPR027417. P-loop_NTPase.
IPR000157. TIR_dom.
[Graphical view]
PfamiPF00931. NB-ARC. 1 hit.
PF01582. TIR. 1 hit.
[Graphical view]
SMARTiSM00369. LRR_TYP. 4 hits.
SM00255. TIR. 1 hit.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 3 hits.
SSF52200. SSF52200. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS51450. LRR. 4 hits.
PS50104. TIR. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q40392-1) [UniParc]FASTAAdd to basket
Also known as: N, Ns

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASSSSSSRW SYDVFLSFRG EDTRKTFTSH LYEVLNDKGI KTFQDDKRLE
60 70 80 90 100
YGATIPGELC KAIEESQFAI VVFSENYATS RWCLNELVKI MECKTRFKQT
110 120 130 140 150
VIPIFYDVDP SHVRNQKESF AKAFEEHETK YKDDVEGIQR WRIALNEAAN
160 170 180 190 200
LKGSCDNRDK TDADCIRQIV DQISSKLCKI SLSYLQNIVG IDTHLEKIES
210 220 230 240 250
LLEIGINGVR IMGIWGMGGV GKTTIARAIF DTLLGRMDSS YQFDGACFLK
260 270 280 290 300
DIKENKRGMH SLQNALLSEL LREKANYNNE EDGKHQMASR LRSKKVLIVL
310 320 330 340 350
DDIDNKDHYL EYLAGDLDWF GNGSRIIITT RDKHLIEKND IIYEVTALPD
360 370 380 390 400
HESIQLFKQH AFGKEVPNEN FEKLSLEVVN YAKGLPLALK VWGSLLHNLR
410 420 430 440 450
LTEWKSAIEH MKNNSYSGII DKLKISYDGL EPKQQEMFLD IACFLRGEEK
460 470 480 490 500
DYILQILESC HIGAEYGLRI LIDKSLVFIS EYNQVQMHDL IQDMGKYIVN
510 520 530 540 550
FQKDPGERSR LWLAKEVEEV MSNNTGTMAM EAIWVSSYSS TLRFSNQAVK
560 570 580 590 600
NMKRLRVFNM GRSSTHYAID YLPNNLRCFV CTNYPWESFP STFELKMLVH
610 620 630 640 650
LQLRHNSLRH LWTETKHLPS LRRIDLSWSK RLTRTPDFTG MPNLEYVNLY
660 670 680 690 700
QCSNLEEVHH SLGCCSKVIG LYLNDCKSLK RFPCVNVESL EYLGLRSCDS
710 720 730 740 750
LEKLPEIYGR MKPEIQIHMQ GSGIRELPSS IFQYKTHVTK LLLWNMKNLV
760 770 780 790 800
ALPSSICRLK SLVSLSVSGC SKLESLPEEI GDLDNLRVFD ASDTLILRPP
810 820 830 840 850
SSIIRLNKLI ILMFRGFKDG VHFEFPPVAE GLHSLEYLNL SYCNLIDGGL
860 870 880 890 900
PEEIGSLSSL KKLDLSRNNF EHLPSSIAQL GALQSLDLKD CQRLTQLPEL
910 920 930 940 950
PPELNELHVD CHMALKFIHY LVTKRKKLHR VKLDDAHNDT MYNLFAYTMF
960 970 980 990 1000
QNISSMRHDI SASDSLSLTV FTGQPYPEKI PSWFHHQGWD SSVSVNLPEN
1010 1020 1030 1040 1050
WYIPDKFLGF AVCYSRSLID TTAHLIPVCD DKMSRMTQKL ALSECDTESS
1060 1070 1080 1090 1100
NYSEWDIHFF FVPFAGLWDT SKANGKTPND YGIIRLSFSG EEKMYGLRLL
1110 1120 1130 1140
YKEGPEVNAL LQMRENSNEP TEHSTGIRRT QYNNRTSFYE LING
Length:1,144
Mass (Da):131,486
Last modified:November 1, 1996 - v1
Checksum:i1EC5B36D4C4BCBB4
GO
Isoform 2 (identifier: Q40392-2) [UniParc]FASTAAdd to basket
Also known as: Ntr, Nl

The sequence of this isoform differs from the canonical sequence as follows:
     617-652: HLPSLRRIDLSWSKRLTRTPDFTGMPNLEYVNLYQC → KKNNIAEKEGDGILIEFWGDLQWAFAVSTEDRSQLV
     653-1144: Missing.

Show »
Length:652
Mass (Da):75,262
Checksum:iDD559795EC7B3E27
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_010126617 – 652HLPSL…NLYQC → KKNNIAEKEGDGILIEFWGD LQWAFAVSTEDRSQLV in isoform 2. CuratedAdd BLAST36
Alternative sequenceiVSP_010127653 – 1144Missing in isoform 2. CuratedAdd BLAST492

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U15605 Genomic DNA. Translation: AAA50763.1.
PIRiA54810.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U15605 Genomic DNA. Translation: AAA50763.1.
PIRiA54810.

3D structure databases

ProteinModelPortaliQ40392.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ40392. 1 interactor.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Family and domain databases

Gene3Di3.40.50.10140. 1 hit.
3.40.50.300. 1 hit.
3.80.10.10. 2 hits.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR002182. NB-ARC.
IPR027417. P-loop_NTPase.
IPR000157. TIR_dom.
[Graphical view]
PfamiPF00931. NB-ARC. 1 hit.
PF01582. TIR. 1 hit.
[Graphical view]
SMARTiSM00369. LRR_TYP. 4 hits.
SM00255. TIR. 1 hit.
[Graphical view]
SUPFAMiSSF52058. SSF52058. 3 hits.
SSF52200. SSF52200. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS51450. LRR. 4 hits.
PS50104. TIR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTMVRN_NICGU
AccessioniPrimary (citable) accession number: Q40392
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: November 1, 1996
Last modified: October 5, 2016
This is version 87 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

Miscellaneousi

Miscellaneous

Isoform 1 and isoform 2 are necessary to confer complete resistance to TMV.

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.