Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q3V5L5 (MGT5B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 82. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B

EC=2.4.1.-
EC=2.4.1.155
Alternative name(s):
Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B
GlcNAc-T Vb
Short name=GNT-Vb
Short name=hGnTVb
Mannoside acetylglucosaminyltransferase 5B
N-acetylglucosaminyl-transferase Vb
N-acetylglucosaminyltransferase IX
Short name=GNT-IX
Gene names
Name:MGAT5B
Synonyms:KIAA2008
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length792 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Glycosyltransferase that acts on alpha-linked mannose of N-glycans and O-mannosyl glycans. Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to the beta 1-6 linkage of the mannose residue of GlcNAcbeta1,2-Manalpha on both the alpha1,3- and alpha1,6-linked mannose arms in the core structure of N-glycan. Also acts on the GlcNAcbeta1,2-Manalpha1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. Plays an active role in modulating integrin and laminin-dependent adhesion and migration of neuronal cells via its activity in the O-mannosyl glycan pathway. Ref.1 Ref.2 Ref.7 Ref.8 Ref.9

Catalytic activity

UDP-N-acetyl-D-glucosamine + 6-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R = UDP + 6-(2,6-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R. Ref.1 Ref.2

Pathway

Protein modification; protein glycosylation.

Subcellular location

Golgi apparatus membrane; Single-pass type II membrane protein By similarity.

Tissue specificity

Predominantly expressed in brain. Expressed in all area of the adult and fetal brain Also expressed at much lower level in testis, spleen and thymus. Ref.1 Ref.2

Sequence similarities

Belongs to the glycosyltransferase 18 family.

Sequence caution

The sequence AAH62354.1 differs from that shown. Reason: Probable cloning artifact.

The sequence AAH63862.1 differs from that shown. Reason: Probable cloning artifact.

The sequence BAB71598.1 differs from that shown. Reason: Chimeric sequence.

The sequence BAD02406.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAE44474.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

Hoxa1P090223EBI-3957727,EBI-3957603From a different organism.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q3V5L5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q3V5L5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MITVNPDGKIMVRRCLVTLRPF → MHSFVKHLCSRYVVERQGTMALPALLTRLLPLR
     475-476: Missing.
Isoform 3 (identifier: Q3V5L5-5)

The sequence of this isoform differs from the canonical sequence as follows:
     475-476: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 792792Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
PRO_0000288611

Regions

Topological domain1 – 2424Cytoplasmic Potential
Transmembrane25 – 4521Helical; Signal-anchor for type II membrane protein; Potential
Topological domain46 – 792747Lumenal Potential

Amino acid modifications

Glycosylation1271N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 2222MITVN…TLRPF → MHSFVKHLCSRYVVERQGTM ALPALLTRLLPLR in isoform 2.
VSP_025731
Alternative sequence475 – 4762Missing in isoform 2 and isoform 3.
VSP_025734
Natural variant701V → I.
Corresponds to variant rs571264 [ dbSNP | Ensembl ].
VAR_032452

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 29, 2007. Version 2.
Checksum: C2EB9445FDBE9429

FASTA79289,535
        10         20         30         40         50         60 
MITVNPDGKI MVRRCLVTLR PFRLFVLGIG FFTLCFLMTS LGGQFSARRL GDSPFTIRTE 

        70         80         90        100        110        120 
VMGGPESRGV LRKMSDLLEL MVKRMDALAR LENSSELHRA GGDLHFPADR MPPGAGLMER 

       130        140        150        160        170        180 
IQAIAQNVSD IAVKVDQILR HSLLLHSKVS EGRRDQCEAP SDPKFPDCSG KVEWMRARWT 

       190        200        210        220        230        240 
SDPCYAFFGV DGTECSFLIY LSEVEWFCPP LPWRNQTAAQ RAPKPLPKVQ AVFRSNLSHL 

       250        260        270        280        290        300 
LDLMGSGKES LIFMKKRTKR LTAQWALAAQ RLAQKLGATQ RDQKQILVHI GFLTEESGDV 

       310        320        330        340        350        360 
FSPRVLKGGP LGEMVQWADI LTALYVLGHG LRVTVSLKEL QSNLGVPPGR GSCPLTMPLP 

       370        380        390        400        410        420 
FDLIYTDYHG LQQMKRHMGL SFKKYRCRIR VIDTFGTEPA YNHEEYATLH GYRTNWGYWN 

       430        440        450        460        470        480 
LNPKQFMTMF PHTPDNSFMG FVSEELNETE KRLIKGGKAS NMAVVYGKEA SIWKLQGKEK 

       490        500        510        520        530        540 
FLGILNKYME IHGTVYYESQ RPPEVPAFVK NHGLLPQPEF QQLLRKAKLF IGFGFPYEGP 

       550        560        570        580        590        600 
APLEAIANGC IFLQSRFSPP HSSLNHEFFR GKPTSREVFS QHPYAENFIG KPHVWTVDYN 

       610        620        630        640        650        660 
NSEEFEAAIK AIMRTQVDPY LPYEYTCEGM LERIHAYIQH QDFCRAPDPA LPEAHAPQSP 

       670        680        690        700        710        720 
FVLAPNATHL EWARNTSLAP GAWPPAHALR AWLAVPGRAC TDTCLDHGLI CEPSFFPFLN 

       730        740        750        760        770        780 
SQDAFLKLQV PCDSTESEMN HLYPAFAQPG QECYLQKEPL LFSCAGSNTK YRRLCPCRDF 

       790 
RKGQVALCQG CL 

« Hide

Isoform 2 [UniParc].

Checksum: B5EC03A96DBFB38B
Show »

FASTA80190,571
Isoform 3 [UniParc].

Checksum: 22193B688EFFACFF
Show »

FASTA79089,294

References

« Hide 'large scale' references
[1]"A novel beta(1,6)-N-acetylglucosaminyltransferase V (GnT-VB)."
Kaneko M., Alvarez-Manilla G., Kamar M., Lee I., Lee J.-K., Troupe K., Zhang W., Osawa M., Pierce M.
FEBS Lett. 554:515-519(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ENZYME ACTIVITY, FUNCTION, TISSUE SPECIFICITY.
[2]"Molecular cloning and characterization of human GnT-IX, a novel beta1,6-N-acetylglucosaminyltransferase that is specifically expressed in the brain."
Inamori K., Endo T., Ide Y., Fujii S., Gu J., Honke K., Taniguchi N.
J. Biol. Chem. 278:43102-43109(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ENZYME ACTIVITY, FUNCTION, TISSUE SPECIFICITY.
Tissue: Brain.
[3]"The nucleotide sequence of a long cDNA clone isolated from human."
Nagase T., Kikuno R., Ohara O.
Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[4]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-341 (ISOFORMS 1/3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 616-792.
Tissue: PNS and Skin.
[6]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 100-306.
Tissue: Brain.
[7]"N-Acetylglucosaminyltransferase IX acts on the GlcNAc beta 1,2-Man alpha 1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan."
Inamori K., Endo T., Gu J., Matsuo I., Ito Y., Fujii S., Iwasaki H., Narimatsu H., Miyoshi E., Honke K., Taniguchi N.
J. Biol. Chem. 279:2337-2340(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[8]"Integrin-dependent neuroblastoma cell adhesion and migration on laminin is regulated by expression levels of two enzymes in the O-mannosyl-linked glycosylation pathway, PomGnT1 and GnT-Vb."
Abbott K.L., Troupe K., Lee I., Pierce M.
Exp. Cell Res. 312:2837-2850(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[9]"N-acetylglucosaminyltransferase VB expression enhances beta1 integrin-dependent PC12 neurite outgrowth on laminin and collagen."
Lee I., Guo H.-B., Kamar M., Abbott K., Troupe K., Lee J.-K., Alvarez-Manilla G., Pierce M.
J. Neurochem. 97:947-956(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
+Additional computationally mapped references.

Web resources

GGDB

GlycoGene database

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB114297 mRNA. Translation: BAD02406.1. Different initiation.
AB109185 mRNA. Translation: BAC84969.1.
AB235153 mRNA. Translation: BAE44474.1. Different initiation.
AC016168 Genomic DNA. No translation available.
BC062354 mRNA. Translation: AAH62354.1. Sequence problems.
BC063862 mRNA. Translation: AAH63862.1. Sequence problems.
AK057861 mRNA. Translation: BAB71598.1. Sequence problems.
RefSeqNP_001186101.1. NM_001199172.1.
NP_653278.2. NM_144677.2.
NP_945193.1. NM_198955.1.
UniGeneHs.144531.

3D structure databases

ProteinModelPortalQ3V5L5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid127000. 2 interactions.
IntActQ3V5L5. 2 interactions.
STRING9606.ENSP00000391227.

Protein family/group databases

CAZyGT18. Glycosyltransferase Family 18.

Polymorphism databases

DMDM152040009.

Proteomic databases

PaxDbQ3V5L5.
PRIDEQ3V5L5.

Protocols and materials databases

DNASU146664.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000301618; ENSP00000301618; ENSG00000167889. [Q3V5L5-5]
ENST00000428789; ENSP00000391227; ENSG00000167889. [Q3V5L5-2]
ENST00000569840; ENSP00000456037; ENSG00000167889. [Q3V5L5-1]
GeneID146664.
KEGGhsa:146664.
UCSCuc002jth.3. human. [Q3V5L5-5]
uc002jti.3. human. [Q3V5L5-2]
uc031rem.1. human. [Q3V5L5-1]

Organism-specific databases

CTD146664.
GeneCardsGC17P074864.
HGNCHGNC:24140. MGAT5B.
HPAHPA017424.
MIM612441. gene.
neXtProtNX_Q3V5L5.
PharmGKBPA134987427.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG270839.
HOGENOMHOG000006557.
HOVERGENHBG052469.
InParanoidQ3V5L5.
KOK09661.
OMANHLYPAF.
OrthoDBEOG71K629.
PhylomeDBQ3V5L5.
TreeFamTF313714.

Enzyme and pathway databases

UniPathwayUPA00378.

Gene expression databases

ArrayExpressQ3V5L5.
BgeeQ3V5L5.
CleanExHS_MGAT5B.
GenevestigatorQ3V5L5.

Family and domain databases

InterProIPR026116. GlyclTrfase_18.
[Graphical view]
PANTHERPTHR15075. PTHR15075. 1 hit.
ProtoNetSearch...

Other

ChiTaRSMGAT5B. human.
GeneWikiMGAT5B.
GenomeRNAi146664.
NextBio85408.
PROQ3V5L5.
SOURCESearch...

Entry information

Entry nameMGT5B_HUMAN
AccessionPrimary (citable) accession number: Q3V5L5
Secondary accession number(s): Q6P3S8 expand/collapse secondary AC list , Q6P6B3, Q766X5, Q76D04, Q96LS2
Entry history
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: April 16, 2014
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM