SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q3V5L5

- MGT5B_HUMAN

UniProt

Q3V5L5 - MGT5B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
Gene
MGAT5B, KIAA2008
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Glycosyltransferase that acts on alpha-linked mannose of N-glycans and O-mannosyl glycans. Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to the beta 1-6 linkage of the mannose residue of GlcNAcbeta1,2-Manalpha on both the alpha1,3- and alpha1,6-linked mannose arms in the core structure of N-glycan. Also acts on the GlcNAcbeta1,2-Manalpha1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. Plays an active role in modulating integrin and laminin-dependent adhesion and migration of neuronal cells via its activity in the O-mannosyl glycan pathway.5 Publications

Catalytic activityi

UDP-N-acetyl-D-glucosamine + 6-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R = UDP + 6-(2,6-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R.2 Publications

Pathwayi

GO - Molecular functioni

  1. alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity Source: UniProtKB-EC
  2. metal ion binding Source: UniProtKB-KW
  3. protein binding Source: IntAct
Complete GO annotation...

GO - Biological processi

  1. protein N-linked glycosylation Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Keywords - Ligandi

Metal-binding

Enzyme and pathway databases

BioCyciMetaCyc:HS15606-MONOMER.
UniPathwayiUPA00378.

Protein family/group databases

CAZyiGT18. Glycosyltransferase Family 18.

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B (EC:2.4.1.-, EC:2.4.1.155)
Alternative name(s):
Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B
GlcNAc-T Vb
Short name:
GNT-Vb
Short name:
hGnTVb
Mannoside acetylglucosaminyltransferase 5B
N-acetylglucosaminyl-transferase Vb
N-acetylglucosaminyltransferase IX
Short name:
GNT-IX
Gene namesi
Name:MGAT5B
Synonyms:KIAA2008
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:24140. MGAT5B.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 2424Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei25 – 4521Helical; Signal-anchor for type II membrane protein; Reviewed prediction
Add
BLAST
Topological domaini46 – 792747Lumenal Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. Golgi membrane Source: UniProtKB-SubCell
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134987427.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 792792Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
PRO_0000288611Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi127 – 1271N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ3V5L5.
PaxDbiQ3V5L5.
PRIDEiQ3V5L5.

Expressioni

Tissue specificityi

Predominantly expressed in brain. Expressed in all area of the adult and fetal brain Also expressed at much lower level in testis, spleen and thymus.2 Publications

Gene expression databases

ArrayExpressiQ3V5L5.
BgeeiQ3V5L5.
CleanExiHS_MGAT5B.
GenevestigatoriQ3V5L5.

Organism-specific databases

HPAiHPA017424.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
Hoxa1P090223EBI-3957727,EBI-3957603From a different organism.

Protein-protein interaction databases

BioGridi127000. 2 interactions.
IntActiQ3V5L5. 2 interactions.
STRINGi9606.ENSP00000391227.

Structurei

3D structure databases

ProteinModelPortaliQ3V5L5.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG270839.
HOGENOMiHOG000006557.
HOVERGENiHBG052469.
InParanoidiQ3V5L5.
KOiK09661.
OMAiNHLYPAF.
OrthoDBiEOG71K629.
PhylomeDBiQ3V5L5.
TreeFamiTF313714.

Family and domain databases

InterProiIPR026116. GlyclTrfase_18.
[Graphical view]
PANTHERiPTHR15075. PTHR15075. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q3V5L5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MITVNPDGKI MVRRCLVTLR PFRLFVLGIG FFTLCFLMTS LGGQFSARRL    50
GDSPFTIRTE VMGGPESRGV LRKMSDLLEL MVKRMDALAR LENSSELHRA 100
GGDLHFPADR MPPGAGLMER IQAIAQNVSD IAVKVDQILR HSLLLHSKVS 150
EGRRDQCEAP SDPKFPDCSG KVEWMRARWT SDPCYAFFGV DGTECSFLIY 200
LSEVEWFCPP LPWRNQTAAQ RAPKPLPKVQ AVFRSNLSHL LDLMGSGKES 250
LIFMKKRTKR LTAQWALAAQ RLAQKLGATQ RDQKQILVHI GFLTEESGDV 300
FSPRVLKGGP LGEMVQWADI LTALYVLGHG LRVTVSLKEL QSNLGVPPGR 350
GSCPLTMPLP FDLIYTDYHG LQQMKRHMGL SFKKYRCRIR VIDTFGTEPA 400
YNHEEYATLH GYRTNWGYWN LNPKQFMTMF PHTPDNSFMG FVSEELNETE 450
KRLIKGGKAS NMAVVYGKEA SIWKLQGKEK FLGILNKYME IHGTVYYESQ 500
RPPEVPAFVK NHGLLPQPEF QQLLRKAKLF IGFGFPYEGP APLEAIANGC 550
IFLQSRFSPP HSSLNHEFFR GKPTSREVFS QHPYAENFIG KPHVWTVDYN 600
NSEEFEAAIK AIMRTQVDPY LPYEYTCEGM LERIHAYIQH QDFCRAPDPA 650
LPEAHAPQSP FVLAPNATHL EWARNTSLAP GAWPPAHALR AWLAVPGRAC 700
TDTCLDHGLI CEPSFFPFLN SQDAFLKLQV PCDSTESEMN HLYPAFAQPG 750
QECYLQKEPL LFSCAGSNTK YRRLCPCRDF RKGQVALCQG CL 792
Length:792
Mass (Da):89,535
Last modified:May 29, 2007 - v2
Checksum:iC2EB9445FDBE9429
GO
Isoform 2 (identifier: Q3V5L5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MITVNPDGKIMVRRCLVTLRPF → MHSFVKHLCSRYVVERQGTMALPALLTRLLPLR
     475-476: Missing.

Show »
Length:801
Mass (Da):90,571
Checksum:iB5EC03A96DBFB38B
GO
Isoform 3 (identifier: Q3V5L5-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     475-476: Missing.

Show »
Length:790
Mass (Da):89,294
Checksum:i22193B688EFFACFF
GO

Sequence cautioni

The sequence AAH62354.1 differs from that shown. Reason: Probable cloning artifact.
The sequence AAH63862.1 differs from that shown. Reason: Probable cloning artifact.
The sequence BAB71598.1 differs from that shown. Reason: Chimeric sequence.
The sequence BAD02406.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAE44474.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti70 – 701V → I.
Corresponds to variant rs571264 [ dbSNP | Ensembl ].
VAR_032452

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2222MITVN…TLRPF → MHSFVKHLCSRYVVERQGTM ALPALLTRLLPLR in isoform 2.
VSP_025731Add
BLAST
Alternative sequencei475 – 4762Missing in isoform 2 and isoform 3.
VSP_025734

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB114297 mRNA. Translation: BAD02406.1. Different initiation.
AB109185 mRNA. Translation: BAC84969.1.
AB235153 mRNA. Translation: BAE44474.1. Different initiation.
AC016168 Genomic DNA. No translation available.
BC062354 mRNA. Translation: AAH62354.1. Sequence problems.
BC063862 mRNA. Translation: AAH63862.1. Sequence problems.
AK057861 mRNA. Translation: BAB71598.1. Sequence problems.
CCDSiCCDS11751.1. [Q3V5L5-5]
CCDS45788.1. [Q3V5L5-2]
CCDS59299.1. [Q3V5L5-1]
RefSeqiNP_001186101.1. NM_001199172.1. [Q3V5L5-1]
NP_653278.2. NM_144677.2. [Q3V5L5-5]
NP_945193.1. NM_198955.1. [Q3V5L5-2]
UniGeneiHs.144531.

Genome annotation databases

EnsembliENST00000301618; ENSP00000301618; ENSG00000167889. [Q3V5L5-5]
ENST00000428789; ENSP00000391227; ENSG00000167889. [Q3V5L5-2]
ENST00000569840; ENSP00000456037; ENSG00000167889. [Q3V5L5-1]
GeneIDi146664.
KEGGihsa:146664.
UCSCiuc002jth.3. human. [Q3V5L5-5]
uc002jti.3. human. [Q3V5L5-2]
uc031rem.1. human. [Q3V5L5-1]

Polymorphism databases

DMDMi152040009.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

GGDB

GlycoGene database

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB114297 mRNA. Translation: BAD02406.1 . Different initiation.
AB109185 mRNA. Translation: BAC84969.1 .
AB235153 mRNA. Translation: BAE44474.1 . Different initiation.
AC016168 Genomic DNA. No translation available.
BC062354 mRNA. Translation: AAH62354.1 . Sequence problems.
BC063862 mRNA. Translation: AAH63862.1 . Sequence problems.
AK057861 mRNA. Translation: BAB71598.1 . Sequence problems.
CCDSi CCDS11751.1. [Q3V5L5-5 ]
CCDS45788.1. [Q3V5L5-2 ]
CCDS59299.1. [Q3V5L5-1 ]
RefSeqi NP_001186101.1. NM_001199172.1. [Q3V5L5-1 ]
NP_653278.2. NM_144677.2. [Q3V5L5-5 ]
NP_945193.1. NM_198955.1. [Q3V5L5-2 ]
UniGenei Hs.144531.

3D structure databases

ProteinModelPortali Q3V5L5.
ModBasei Search...

Protein-protein interaction databases

BioGridi 127000. 2 interactions.
IntActi Q3V5L5. 2 interactions.
STRINGi 9606.ENSP00000391227.

Protein family/group databases

CAZyi GT18. Glycosyltransferase Family 18.

Polymorphism databases

DMDMi 152040009.

Proteomic databases

MaxQBi Q3V5L5.
PaxDbi Q3V5L5.
PRIDEi Q3V5L5.

Protocols and materials databases

DNASUi 146664.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000301618 ; ENSP00000301618 ; ENSG00000167889 . [Q3V5L5-5 ]
ENST00000428789 ; ENSP00000391227 ; ENSG00000167889 . [Q3V5L5-2 ]
ENST00000569840 ; ENSP00000456037 ; ENSG00000167889 . [Q3V5L5-1 ]
GeneIDi 146664.
KEGGi hsa:146664.
UCSCi uc002jth.3. human. [Q3V5L5-5 ]
uc002jti.3. human. [Q3V5L5-2 ]
uc031rem.1. human. [Q3V5L5-1 ]

Organism-specific databases

CTDi 146664.
GeneCardsi GC17P074864.
HGNCi HGNC:24140. MGAT5B.
HPAi HPA017424.
MIMi 612441. gene.
neXtProti NX_Q3V5L5.
PharmGKBi PA134987427.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG270839.
HOGENOMi HOG000006557.
HOVERGENi HBG052469.
InParanoidi Q3V5L5.
KOi K09661.
OMAi NHLYPAF.
OrthoDBi EOG71K629.
PhylomeDBi Q3V5L5.
TreeFami TF313714.

Enzyme and pathway databases

UniPathwayi UPA00378 .
BioCyci MetaCyc:HS15606-MONOMER.

Miscellaneous databases

ChiTaRSi MGAT5B. human.
GeneWikii MGAT5B.
GenomeRNAii 146664.
NextBioi 85408.
PROi Q3V5L5.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q3V5L5.
Bgeei Q3V5L5.
CleanExi HS_MGAT5B.
Genevestigatori Q3V5L5.

Family and domain databases

InterProi IPR026116. GlyclTrfase_18.
[Graphical view ]
PANTHERi PTHR15075. PTHR15075. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ENZYME ACTIVITY, FUNCTION, TISSUE SPECIFICITY.
  2. "Molecular cloning and characterization of human GnT-IX, a novel beta1,6-N-acetylglucosaminyltransferase that is specifically expressed in the brain."
    Inamori K., Endo T., Ide Y., Fujii S., Gu J., Honke K., Taniguchi N.
    J. Biol. Chem. 278:43102-43109(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ENZYME ACTIVITY, FUNCTION, TISSUE SPECIFICITY.
    Tissue: Brain.
  3. "The nucleotide sequence of a long cDNA clone isolated from human."
    Nagase T., Kikuno R., Ohara O.
    Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-341 (ISOFORMS 1/3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 616-792.
    Tissue: PNS and Skin.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 100-306.
    Tissue: Brain.
  7. "N-Acetylglucosaminyltransferase IX acts on the GlcNAc beta 1,2-Man alpha 1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan."
    Inamori K., Endo T., Gu J., Matsuo I., Ito Y., Fujii S., Iwasaki H., Narimatsu H., Miyoshi E., Honke K., Taniguchi N.
    J. Biol. Chem. 279:2337-2340(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  8. "Integrin-dependent neuroblastoma cell adhesion and migration on laminin is regulated by expression levels of two enzymes in the O-mannosyl-linked glycosylation pathway, PomGnT1 and GnT-Vb."
    Abbott K.L., Troupe K., Lee I., Pierce M.
    Exp. Cell Res. 312:2837-2850(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  9. "N-acetylglucosaminyltransferase VB expression enhances beta1 integrin-dependent PC12 neurite outgrowth on laminin and collagen."
    Lee I., Guo H.-B., Kamar M., Abbott K., Troupe K., Lee J.-K., Alvarez-Manilla G., Pierce M.
    J. Neurochem. 97:947-956(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiMGT5B_HUMAN
AccessioniPrimary (citable) accession number: Q3V5L5
Secondary accession number(s): Q6P3S8
, Q6P6B3, Q766X5, Q76D04, Q96LS2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: July 9, 2014
This is version 85 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi