Q3V5L5 (MGT5B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 75.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B EC=2.4.1.- EC=2.4.1.155 Alternative name(s): Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B GlcNAc-T Vb Short name=GNT-Vb Short name=hGnTVb Mannoside acetylglucosaminyltransferase 5B N-acetylglucosaminyl-transferase Vb N-acetylglucosaminyltransferase IX Short name=GNT-IX | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 792 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Glycosyltransferase that acts on alpha-linked mannose of N-glycans and O-mannosyl glycans. Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to the beta 1-6 linkage of the mannose residue of GlcNAcbeta1,2-Manalpha on both the alpha1,3- and alpha1,6-linked mannose arms in the core structure of N-glycan. Also acts on the GlcNAcbeta1,2-Manalpha1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. Plays an active role in modulating integrin and laminin-dependent adhesion and migration of neuronal cells via its activity in the O-mannosyl glycan pathway. Ref.1 Ref.2 Ref.7 Ref.8 Ref.9 |
| Catalytic activity | UDP-N-acetyl-D-glucosamine + 6-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R = UDP + 6-(2,6-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R. Ref.1 Ref.2 |
| Cofactor | Divalent metal cations. According to Ref.2, divalent metal cations do not effect enzyme activity. Ref.1 Ref.2 |
| Pathway | |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein By similarity. |
| Tissue specificity | Predominantly expressed in brain. Expressed in all area of the adult and fetal brain Also expressed at much lower level in testis, spleen and thymus. Ref.1 Ref.2 |
| Sequence similarities | Belongs to the glycosyltransferase 18 family. |
| Sequence caution | The sequence AAH62354.1 differs from that shown. Reason: Probable cloning artifact. The sequence AAH63862.1 differs from that shown. Reason: Probable cloning artifact. The sequence BAB71598.1 differs from that shown. Reason: Chimeric sequence. The sequence BAD02406.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAE44474.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Ligand | Metal-binding |
| Molecular function | Glycosyltransferase Transferase |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein N-linked glycosylation Inferred from electronic annotation. Source: InterPro |
| Cellular_component | Golgi membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity Inferred from electronic annotation. Source: EC metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Hoxa1 | P09022 | 3 | EBI-3957727,EBI-3957603 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q3V5L5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q3V5L5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-22: MITVNPDGKIMVRRCLVTLRPF → MHSFVKHLCSRYVVERQGTMALPALLTRLLPLR 475-476: Missing. | ||||||
| Isoform 3 (identifier: Q3V5L5-5) The sequence of this isoform differs from the canonical sequence as follows: 475-476: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 792 | 792 | Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B | PRO_0000288611 | |||||
Regions | |||||||||
| Topological domain | 1 – 24 | 24 | Cytoplasmic Potential | ||||||
| Transmembrane | 25 – 45 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 46 – 792 | 747 | Lumenal Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 127 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 22 | 22 | MITVN…TLRPF → MHSFVKHLCSRYVVERQGTM ALPALLTRLLPLR in isoform 2. | VSP_025731 | |||||
| Alternative sequence | 475 – 476 | 2 | Missing in isoform 2 and isoform 3. | VSP_025734 | |||||
| Natural variant | 70 | 1 | V → I. Corresponds to variant rs571264 [ dbSNP | Ensembl ]. | VAR_032452 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel beta(1,6)-N-acetylglucosaminyltransferase V (GnT-VB)." Kaneko M., Alvarez-Manilla G., Kamar M., Lee I., Lee J.-K., Troupe K., Zhang W., Osawa M., Pierce M. FEBS Lett. 554:515-519(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ENZYME ACTIVITY, FUNCTION, COFACTOR, TISSUE SPECIFICITY. |
| [2] | "Molecular cloning and characterization of human GnT-IX, a novel beta1,6-N-acetylglucosaminyltransferase that is specifically expressed in the brain." Inamori K., Endo T., Ide Y., Fujii S., Gu J., Honke K., Taniguchi N. J. Biol. Chem. 278:43102-43109(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ENZYME ACTIVITY, FUNCTION, COFACTOR, TISSUE SPECIFICITY. Tissue: Brain. |
| [3] | "The nucleotide sequence of a long cDNA clone isolated from human." Nagase T., Kikuno R., Ohara O. Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-341 (ISOFORMS 1/3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 616-792. Tissue: PNS and Skin. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 100-306. Tissue: Brain. |
| [7] | "N-Acetylglucosaminyltransferase IX acts on the GlcNAc beta 1,2-Man alpha 1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan." Inamori K., Endo T., Gu J., Matsuo I., Ito Y., Fujii S., Iwasaki H., Narimatsu H., Miyoshi E., Honke K., Taniguchi N. J. Biol. Chem. 279:2337-2340(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [8] | "Integrin-dependent neuroblastoma cell adhesion and migration on laminin is regulated by expression levels of two enzymes in the O-mannosyl-linked glycosylation pathway, PomGnT1 and GnT-Vb." Abbott K.L., Troupe K., Lee I., Pierce M. Exp. Cell Res. 312:2837-2850(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [9] | "N-acetylglucosaminyltransferase VB expression enhances beta1 integrin-dependent PC12 neurite outgrowth on laminin and collagen." Lee I., Guo H.-B., Kamar M., Abbott K., Troupe K., Lee J.-K., Alvarez-Manilla G., Pierce M. J. Neurochem. 97:947-956(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Web resources
| GGDB GlycoGene database |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB114297 mRNA. Translation: BAD02406.1. Different initiation. AB109185 mRNA. Translation: BAC84969.1. AB235153 mRNA. Translation: BAE44474.1. Different initiation. AC016168 Genomic DNA. No translation available. BC062354 mRNA. Translation: AAH62354.1. Sequence problems. BC063862 mRNA. Translation: AAH63862.1. Sequence problems. AK057861 mRNA. Translation: BAB71598.1. Sequence problems. |
| IPI | IPI00440497. IPI00441187. IPI00746336. IPI00848338. IPI00940587. |
| RefSeq | NP_001186101.1. NM_001199172.1. NP_653278.2. NM_144677.2. NP_945193.1. NM_198955.1. |
| UniGene | Hs.144531. |
3D structure databases | |
| ProteinModelPortal | Q3V5L5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q3V5L5. 1 interaction. |
| STRING | 9606.ENSP00000391227. |
Protein family/group databases | |
| CAZy | GT18. Glycosyltransferase Family 18. |
Polymorphism databases | |
| DMDM | 152040009. |
Proteomic databases | |
| PaxDb | Q3V5L5. |
| PRIDE | Q3V5L5. |
Protocols and materials databases | |
| DNASU | 146664. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000301618; ENSP00000301618; ENSG00000167889. ENST00000428789; ENSP00000391227; ENSG00000167889. ENST00000569840; ENSP00000456037; ENSG00000167889. |
| GeneID | 146664. |
| KEGG | hsa:146664. |
| UCSC | uc002jth.3. human. uc002jti.3. human. uc002jtj.3. human. |
Organism-specific databases | |
| CTD | 146664. |
| GeneCards | GC17P074864. |
| HGNC | HGNC:24140. MGAT5B. |
| HPA | HPA017424. |
| MIM | 612441. gene. |
| neXtProt | NX_Q3V5L5. |
| PharmGKB | PA134987427. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG270839. |
| HOGENOM | HOG000006557. |
| HOVERGEN | HBG052469. |
| InParanoid | Q3V5L5. |
| KO | K09661. |
| OMA | DHGLICE. |
| OrthoDB | EOG4VMFDR. |
Enzyme and pathway databases | |
| UniPathway | UPA00378. |
Gene expression databases | |
| ArrayExpress | Q3V5L5. |
| Bgee | Q3V5L5. |
| CleanEx | HS_MGAT5B. |
| Genevestigator | Q3V5L5. |
Family and domain databases | |
| InterPro | IPR026116. GlyclTrfase_18. [Graphical view] |
| PANTHER | PTHR15075. PTHR15075. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MGAT5B. human. |
| GenomeRNAi | 146664. |
| NextBio | 85408. |
| SOURCE | Search... |
Entry information
| Entry name | MGT5B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q3V5L5 Secondary accession number(s): Q6P3S8 Q96LS2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
